CSNK2B Polyclonal antibody

CSNK2B Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 22418-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

Casein Kinase 2 beta, Casein kinase II subunit beta, CK II beta, CK2B, CK2N

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, NIH/3T3 cells, K-562 cells, MCF-7 cells
Positive IHC detected inhuman testis tissue, human thyroid tissue, mouse testis tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

22418-1-AP targets CSNK2B in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18134

Product name: Recombinant human CSNK2B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-215 aa of BC112017

Sequence: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR

Predict reactive species
Full Name casein kinase 2, beta polypeptide
Calculated Molecular Weight 215 aa, 25 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC112017
Gene Symbol CSNK2B
Gene ID (NCBI) 1460
RRIDAB_2879102
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP67870
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CSNK2B is a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. It participates in Wnt signaling, and plays a complex role in regulating the basal catalytic activity of the alpha subunit.

Protocols

Product Specific Protocols
WB protocol for CSNK2B antibody 22418-1-APDownload protocol
IHC protocol for CSNK2B antibody 22418-1-APDownload protocol
FC protocol for CSNK2B antibody 22418-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Biochem Biophys Res Commun

β-catenin stimulates Tcf7l1 degradation through recruitment of casein kinase 2 in mouse embryonic stem cells.

Authors - Yan Zhang
humanWB

Cancer Metab

Phosphoproteomics revealed cellular signals immediately responding to disruption of cancer amino acid homeostasis induced by inhibition of l-type amino acid transporter 1

Authors - Hiroki Okanishi
humanWB

Nat Immunol

GIMAP5 deficiency reveals a mammalian ceramide-driven longevity assurance pathway

Authors - Ann Y Park
Loading...
||
New chat Able
正在加载,请稍候...