Product Information
85403-2-PBS targets CST1 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag8862 Product name: Recombinant human CST1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-141 aa of BC021225 Sequence: KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES Predict reactive species |
| Full Name | cystatin SN |
| Calculated Molecular Weight | 141 aa, 16 kDa |
| GenBank Accession Number | BC021225 |
| Gene Symbol | CST1 |
| Gene ID (NCBI) | 1469 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01037 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
