CTNNBIP1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00102-1

  Sandwich ELISA standard curve of MP00102-1, Human CTNNBIP1 Recombinant Matched Antibody Pair - PBS only. 82914-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag13160. 82914-2-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL

• 

  Sample test of MP00102-1

  Hela and HepG2 cell lysates were measured. The human CTNNBIP1 concentration of detected samples was determined to be 1,205.0 pg/mL (based on a 1.50 mg/mL extract load) in Hela cell lysate and 1486.5 pg/mL (based on a 1.20 mg/mL extract load) in HepG2 cell lysate.

• 

  Cytometric bead array standard curve of MP00102-1

  Cytometric bead array standard curve of MP00102-1, CTNNBIP1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 82914-4-PBS. Detection antibody: 82914-2-PBS. Standard: Ag13160. Range: 0.313-20 ng/mL.

• 

  Affinity and Kinetic Characterization of 82914-4-PBS

  Biolayer interferometry (BLl) kinetic assay of 82914-4-PBS against Human CTNNBIP1 was performed. The affinity constant is 1.21 nM.

CTNNBIP1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 82914-4-PBS

Clone No.230164G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Beta-catenin-interacting protein 1, ICAT, Inhibitor of beta-catenin and Tcf-4

---

Product Information

82914-4-PBS targets CTNNBIP1 as part of a matched antibody pair:

MP00102-1: 82914-4-PBS capture and 82914-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13160

  Product name: Recombinant human CTNNBIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-81 aa of BC014300

  Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

• Full Name: catenin, beta interacting protein 1
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC014300
• Gene Symbol: CTNNBIP1
• Gene ID (NCBI): 56998
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NSA3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.