• Featured Product
  • KD/KO Validated

Cathepsin D Polyclonal antibody

Cathepsin D Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 21327-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, ELISA

CTSD, Cathepsin D heavy chain, Cathepsin D light chain, CLN10, CPSD

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, HCT 116 cells, HuH-7 cells, HepG2 cells, MCF-7 cells
Positive IHC detected inhuman hepatocirrhosis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21327-1-AP targets Cathepsin D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15254

Product name: Recombinant human Cathepsin D protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 59-412 aa of BC016320

Sequence: VPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Predict reactive species
Full Name cathepsin D
Calculated Molecular Weight 412 aa, 45 kDa
Observed Molecular Weight 32 kDa, 48 kDa, 52 kDa
GenBank Accession NumberBC016320
Gene Symbol Cathepsin D
Gene ID (NCBI) 1509
RRIDAB_10733646
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP07339
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CTSD (Cathepsin D) also named CPSD, belongs to the peptidase A1 family. It is ubiquitously expressed and is involved in proteolytic degradation, cell invasion, and apoptosis. Human CTSD is synthesized as a 52-kDa precursor that is converted into an active 48-kDa single-chain intermediate in the endosomes, and then into a fully active mature form, composed of a 34-kDa heavy chain and a 14-kDa light chain, in the lysosomes. It is a lysosomal acid protease found in neutrophils and monocytes and involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease (PMID: 27114232, PMID: 30717773, PMID: 30051532).

Protocols

Product Specific Protocols
WB protocol for Cathepsin D antibody 21327-1-APDownload protocol
IHC protocol for Cathepsin D antibody 21327-1-APDownload protocol
IF protocol for Cathepsin D antibody 21327-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Acta Neuropathol

Wolframin is a novel regulator of tau pathology and neurodegeneration.

Authors - Shuo Chen
mouseWB

Mol Cell

Itaconate is a lysosomal inducer that promotes antibacterial innate immunity.

Authors - Zhenxing Zhang
mouseWB

Acta Pharm Sin B

Nuciferine protects against high-fat diet-induced hepatic steatosis and insulin resistance via activating TFEB-mediated autophagy-lysosomal pathway.

Authors - Xiliang Du
humanWB

Autophagy

Atractylenolide I inhibits angiogenesis and reverses sunitinib resistance in clear cell renal cell carcinoma through ATP6V0D2-mediated autophagic degradation of EPAS1/HIF2α

Authors - Qinyu Li
mouseWB,IF

Redox Biol

Cyclic helix B peptide alleviates proinflammatory cell death and improves functional recovery after traumatic spinal cord injury

Authors - Yu Xu
mouse,humanWB,IF

Autophagy

Restoration of CTSD (cathepsin D) and lysosomal function in stroke is neuroprotective.

Authors - M Iqbal Hossain
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tae Yeon (Verified Customer) (09-02-2025)

Good puncta staining to detect lysosomal enzyme

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Human, mouse, iPSC-derived organoids
FH

aude (Verified Customer) (05-26-2025)

Sat 5% milk Incubation Primary Ab ON at 4°C

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/10000
  • Cell Tissue Type: 48h conditioned media of TNBC cell lines
Cathepsin D Antibody Western Blot validation (1/10000 dilution) in 48h conditioned media of TNBC cell lines (Cat no:21327-1-AP)
FH

Chen (Verified Customer) (06-01-2021)

Very good to detect cathepsin D in postmortem human samples with Western blotting

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: postmortem human brain lysate
Cathepsin D Antibody Western Blot validation (1:3000 dilution) in postmortem human brain lysate (Cat no:21327-1-AP)
FH

Efil (Verified Customer) (05-29-2019)

cells were fixed in cold MeOH for 8 minutes

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: human fibroblasts
Cathepsin D Antibody Immunofluorescence, validation (1:100 dilution) in human fibroblasts (Cat no:21327-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...