CUL3 Recombinant monoclonal antibody, PBS Only

CUL3 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83619-3-PBS
Clone No.240534D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

CUL-3, Cullin-3, KIAA0617

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83619-3-PBS targets CUL3 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1555

Product name: Recombinant human CUL3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 469-768 aa of BC039598

Sequence: KLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA

Predict reactive species
Full Name cullin 3
Calculated Molecular Weight 89 kDa
GenBank Accession NumberBC039598
Gene Symbol CUL3
Gene ID (NCBI) 8452
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13618
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...