CX3CR1 Monoclonal antibody

• 

  WB analysis using 66915-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66915-1-Ig (CX3CR1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 66915-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66915-1-Ig (CX3CR1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 66915-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66915-1-Ig (CX3CR1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse kidney using 66915-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using CX3CR1 antibody (66915-1-Ig, Clone: 3D3B8 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

CX3CR1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66915-1-Ig

Clone No.3D3B8

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

Beta chemokine receptor like 1, Beta chemokine receptor-like 1, C X3 C CKR 1, CCRL1, CMK BRL 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, SH-SY5Y cells, U-937 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below

Product Information

66915-1-Ig targets CX3CR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27698

  Product name: Recombinant human CX3CR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 56-231 aa of BC028078

  Sequence: LTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIK

• Full Name: chemokine (C-X3-C motif) receptor 1
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC028078
• Gene Symbol: CX3CR1
• Gene ID (NCBI): 1524
• RRID: AB_2882242
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49238
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CX3CR1, also known as GPR13, V28, and fractalkine receptor, belongs to the 7-transmembrane G protein-coupled receptor (GPCR) family. It is expressed in microglia, astrocytes, NK cells, monocytes/macrophages, and a subpopulation of T cells. CX3CR1 is the receptor for fractalkine (CX3CL1) and mediates both its adhesive and migratory functions. It also acts as a coreceptor with CD4 for HIV-1 virus envelope protein (in vitro), and some variations in the gene of CX3CR1 lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Defects in CX3CR1 are a cause of susceptibility to age-related macular degeneration type 12 (ARMD12).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Regen Biomater; Functionalized biomimetic nanoparticles are delivered from the nose to the brain for the synergistic targeted treatment of cerebral ischemia/reperfusion injury.; Authors - Yuanyuan Wu
mouse	WB	Adv Sci (Weinh); Artificial Microglia Nanoplatform Loaded With Anti-RGMa in Acoustic/Magnetic Feld for Recanalization and Neuroprotection in Acute Ischemic Stroke; Authors - Ruiqi Cheng
human	IF	Pathol Res Pract; Multi-omic and functional analyses identified an endoplasmic reticulum stress-driven TIMD4⁺ IL1β⁺ macrophage subpopulation contributes to osteoarthritis progression.; Authors - Ruicong Hao