CXCL11 Polyclonal antibody

CXCL11 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 10707-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

CXCL-11, Interferon gamma-inducible protein 9, H174, CXCL 11, C-X-C motif chemokine 11

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inIFN gamma, LPS and Brefeldin A treated THP-1 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10707-1-AP targets CXCL11 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1087

Product name: Recombinant human CXCL11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-94 aa of BC005292

Sequence: MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 11
Calculated Molecular Weight 10 kDa
Observed Molecular Weight10 kDa
GenBank Accession NumberBC005292
Gene Symbol CXCL11
Gene ID (NCBI) 6373
RRIDAB_2088022
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14625
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL11, also known as IFN-inducible T-cell α-chemoattractant (I-TAC), is a member of the ELR-negative CXC chemokine family. It is produced by various cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs). CXCL11 signals through the chemokine receptors CXCR3 and CXCR7 . This chemokine is associated with multiple functions such as chemotactic migration, regulation of cell proliferation and self-renewal, increasing cell adhesion, and modulation of angiostatic effects.

Protocols

Product Specific Protocols
IHC protocol for CXCL11 antibody 10707-1-APDownload protocol
WB protocol for CXCL11 antibody 10707-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Brain Res Bull

Silent information regulator 1 ameliorates oxidative stress injury via PGC-1α/PPARγ-Nrf2 pathway after ischemic stroke in rat.

Authors - Yang Zhou
humanIHC

Biomedicines

Identification and Preliminary Clinical Validation of Key Extracellular Proteins as the Potential Biomarkers in Hashimoto's Thyroiditis by Comprehensive Analysis

Authors - Zihan Xi
humanIHC

Cancer Immunol Immunother

Comprehensive analysis of the relationship between ubiquitin-specific protease 21 (USP21) and prognosis, tumor microenvironment infiltration, and therapy response in colorectal cancer

Authors - Haihang Nie

Signal Transduct Target Ther

Ultra-high dose rate radiotherapy overcomes radioresistance in head and neck squamous cell carcinoma

Authors - Hong-Shuai Li
humanIF

Arthritis Res Ther

Integrated analysis of dermatomyositis reveals heterogeneous immune infiltration and interstitial lung disease-associated endotype

Authors - Xinzhi Xu
Loading...
||
New chat Able
正在加载,请稍候...