CXCL11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CXCL11 Polyclonal antibody (10707-1-AP)

CXCL11 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10707-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

CXCL-11, C X C motif chemokine 11, C-X-C motif chemokine 11, CXCL 11, H174

• 

  WB analysis using 10707-1-AP

  IFN gamma, LPS and Brefeldin A treated THP-1 cells were subjected to SDS PAGE followed by western blot with 10707-1-AP (CXCL11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10707-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10707-1-AP (CXCL11 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10707-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10707-1-AP (CXCL11 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CXCL11 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: IFN gamma, LPS and Brefeldin A treated THP-1 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10707-1-AP targets CXCL11 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1087

  Product name: Recombinant human CXCL11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-94 aa of BC005292

  Sequence: MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

• Full Name: chemokine (C-X-C motif) ligand 11
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC005292
• Gene Symbol: CXCL11
• Gene ID (NCBI): 6373
• RRID: AB_2088022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14625
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL11, also known as IFN-inducible T-cell α-chemoattractant (I-TAC), is a member of the ELR-negative CXC chemokine family. It is produced by various cells including leukocytes, fibroblasts, and endothelial cells upon stimulation with interferons (IFNs). CXCL11 signals through the chemokine receptors CXCR3 and CXCR7 . This chemokine is associated with multiple functions such as chemotactic migration, regulation of cell proliferation and self-renewal, increasing cell adhesion, and modulation of angiostatic effects.

Publications

What published studies show

The CXCL11 antibody (Cat# 10707-1-AP) has 11 total citations spanning journals including Signal Transduction and Targeted Therapy, MedComm, Journal of Translational Medicine, Frontiers in Immunology, Cancer Immunology & Immunotherapy, International Immunopharmacology, Arthritis Research & Therapy, Translational Oncology, Biomedicines, Brain Research Bulletin, and Open Life Sciences. Research fields cover tumor immunology (colorectal, lung, pancreatic, and head and neck cancers), autoimmune diseases (dermatomyositis, Hashimoto's thyroiditis), ARDS, and ischemic stroke.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Signal Transduct Target Ther; Ultra-high dose rate radiotherapy overcomes radioresistance in head and neck squamous cell carcinoma; Authors - Hong-Shuai Li
human	IHC	MedComm (2020); Inhibiting ADAR1-Mediated Excessive Epigenetic A-to-I RNA Editing Improves the Immune Microenvironment and Increases Sensitivity to Immunotherapy in Lung Adenocarcinoma.; Authors - Sihui Wang
human	WB	J Transl Med; Dual immunosuppression mechanism induced by PTP1B in colorectal cancer: upregulation of PD-L1 by FOXO1/miR-34C/c-MYC axis and inhibition of the infiltration of CD8(+) T cell by downregulating of CXCL11.; Authors - Zihan Wang
		Front Immunol; CRTC1 enhances PD-L1-mediated tumor immunosuppression in non-small cell lung cancer via the Notch1/Akt signaling pathway; Authors - Xujun Feng
human	IHC	Cancer Immunol Immunother; Comprehensive analysis of the relationship between ubiquitin-specific protease 21 (USP21) and prognosis, tumor microenvironment infiltration, and therapy response in colorectal cancer; Authors - Haihang Nie
mouse	WB	Int Immunopharmacol; Rab32-mediated macrophage apoptosis and apoptotic body release promote M1 polarization in ARDS via the Cxcl11/Ccl4/NF-κB pathway.; Authors - Di Wu