Tested Applications
Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | Jurkat cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 28 publications below |
IHC | See 22 publications below |
IF | See 24 publications below |
Product Information
17402-1-AP targets CXCL12/SDF-1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag11379 Product name: Recombinant human CXCL12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-89 aa of BC039893 Sequence: SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Predict reactive species |
Full Name | chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) |
Calculated Molecular Weight | 89 aa, 10 kDa |
GenBank Accession Number | BC039893 |
Gene Symbol | CXCL12/SDF-1 |
Gene ID (NCBI) | 6387 |
RRID | AB_2878404 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P48061 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
In adulthood, CXCL12 plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism (PMID: 17878755). It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumour progression (PMID: 16943240). CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12 (PMID: 11242036 ). In breast cancer, however, increased expression of CXCL12 determines a reduced risk of distant metastasis (PMID: 19646861; 17724466 ). This antibody can detect all the isoforms of CXCL12/SDF1.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for CXCL12/SDF-1 antibody 17402-1-AP | Download protocol |
IF protocol for CXCL12/SDF-1 antibody 17402-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Acta Biomater Sodium alginate/collagen/stromal cell-derived factor-1 neural scaffold loaded with BMSCs promotes neurological function recovery after traumatic brain injury. | ||
Biomed Pharmacother Angelica sinensis polysaccharides ameliorated 5-Fluorouracil-induced damage of early B cell progenitors by alleviating oxidative stress of IL-7 producing mesenchymal stem and progenitor cells | ||
Breast Cancer Res CXCR4 promotes tumor stemness maintenance and CDK4/6 inhibitors resistance in ER-positive breast cancer | ||
Mol Oncol Growth arrest-specific protein 2 (GAS2) interacts with CXCR4 to promote T-cell leukemogenesis partially via c-MYC | ||
J Nanobiotechnology Magnetic targeting enhances the cutaneous wound healing effects of human mesenchymal stem cell-derived iron oxide exosomes. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Yohanes (Verified Customer) (09-16-2022) | Good specificity antibody for immunofluoresence experiment.
![]() |