• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CXCL12/SDF-1 Polyclonal antibody

CXCL12/SDF-1 Polyclonal Antibody for FC (Intra)
Cat No. CL488-17402

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

CXCL12, C-X-C motif chemokine 12, hIRH, hSDF-1, IRH

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17402 targets CXCL12/SDF-1 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11379

Product name: Recombinant human CXCL12 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 19-89 aa of BC039893

Sequence: SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
Calculated Molecular Weight 89 aa, 10 kDa
GenBank Accession NumberBC039893
Gene Symbol CXCL12/SDF-1
Gene ID (NCBI) 6387
RRIDAB_3672674
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP48061
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

In adulthood, CXCL12 plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism (PMID: 17878755). It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumour progression (PMID: 16943240). CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12 (PMID: 11242036 ). In breast cancer, however, increased expression of CXCL12 determines a reduced risk of distant metastasis (PMID: 19646861; 17724466 ). This antibody can detect all the isoforms of CXCL12/SDF1.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CXCL12/SDF-1 antibody CL488-17402Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...