Product Information
85647-2-PBS targets CXCL4/PF4 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2129 Product name: Recombinant Human CXCL4/PF4 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-101 aa of NM_002619.4 Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Predict reactive species |
| Full Name | platelet factor 4 |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | NM_002619.4 |
| Gene Symbol | PF4 |
| Gene ID (NCBI) | 5196 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P02776 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
