CXCL4/PF4 Recombinant monoclonal antibody, PBS Only

• 

CXCL4/PF4 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85647-2-PBS

Clone No.243087D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

CXCL4, PF4, SCYB4, C X C motif chemokine 4, C-X-C motif chemokine 4

---

Product Information

85647-2-PBS targets CXCL4/PF4 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2129

  Product name: Recombinant Human CXCL4/PF4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 32-101 aa of NM_002619.4

  Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

• Full Name: platelet factor 4
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: NM_002619.4
• Gene Symbol: PF4
• Gene ID (NCBI): 5196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02776
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.