Product Information
86222-2-PBS targets CXCL7/PPBP as part of a matched antibody pair:
MP02338-1: 86222-2-PBS capture and 86222-1-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3405 Product name: recombinant rat CXCL7/Thymus Chemokine-1 protein Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 46-107 aa of NM_153721.1 Sequence: IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI Predict reactive species |
| Full Name | pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) |
| Calculated Molecular Weight | 12 kDa |
| GenBank Accession Number | NM_153721.1 |
| Gene Symbol | Ppbp |
| Gene ID (NCBI) | 246358 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99ME0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
