Product Information
84427-3-PBS targets CXCL9/MIG in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17932 Product name: Recombinant human CXCL9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-125 aa of BC095396 Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 9 |
| Calculated Molecular Weight | 14 kDa |
| GenBank Accession Number | BC095396 |
| Gene Symbol | CXCL9 |
| Gene ID (NCBI) | 4283 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q07325 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
