CXCL9/MIG Recombinant monoclonal antibody

• 

  WB analysis using 84427-4-RR

  IFN gamma and LPS treated THP-1 cells were subjected to SDS PAGE followed by western blot with 84427-4-RR (CXCL9 antibody) at dilution of 1:10000 and incubated at room temperature for 1.5 hours.

• 

  WB analysis using 84427-4-RR

  IFN gamma treated THP-1 cells were subjected to SDS PAGE followed by western blot with 84427-4-RR (CXCL9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

CXCL9/MIG Recombinant Antibody for WB, ELISA

Cat No. 84427-4-RR

Clone No.241437F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

MIG; CXCL9, MIG, CXCL9, C-X-C motif chemokine 9, CMK

---

Tested Applications

• Positive WB detected in: LPS and IFN gamma treated THP-1 cells, IFN gamma treated THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84427-4-RR targets CXCL9/MIG in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17932

  Product name: Recombinant human CXCL9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-125 aa of BC095396

  Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

• Full Name: chemokine (C-X-C motif) ligand 9
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC095396
• Gene Symbol: CXCL9
• Gene ID (NCBI): 4283
• RRID: AB_3671954
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q07325
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL9 is a small cytokine known as MIG. CXCL9 is a T-cell chemoattractant, which is induced by IFN-γ. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. A high level of CXCL9 revealed in peripheral liquids, can be considered as a marker of host immune response, especially of that involving Th1 cells.