Product Information
84655-3-PBS targets CXCR3 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2269 Product name: Recombinant Human CXCR3 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-53 aa of BC034403 Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR Predict reactive species |
| Full Name | chemokine (C-X-C motif) receptor 3 |
| Calculated Molecular Weight | 368 aa, 41 kDa |
| GenBank Accession Number | BC034403 |
| Gene Symbol | CXCR3 |
| Gene ID (NCBI) | 2833 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P49682 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
