Anti-Mouse CXCR4/CD184 Rabbit Recombinant Antibody

• 

  FC experiment of mouse thymocytes using 98233-1-RR

  1x10^6 mouse thymocytes were surface stained with 0.25 ug Anti-Mouse CXCR4/CD184 Rabbit Recombinant Antibody (98233-1-RR, Clone: 241956H2) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 647 Anti-Mouse CD4 (GK1.5) (CL647-65104, Clone: GK1.5). Cells were not fixed.

• 

  FC experiment of mouse thymocytes using 98233-1-RR

  1x10^6 mouse thymocytes were surface stained with 0.25 ug Anti-Mouse CXCR4/CD184 Rabbit Recombinant Antibody (98233-1-RR, Clone: 241956H2)(red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98233-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98233-1-RR against Mouse CXCR4/CD184 were performed. The affinity constant is 1.71 nM.

CXCR4/CD184 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98233-1-RR

Clone No.241956H2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241956H2, CD184, Cmkar4, C-X-C chemokine receptor type 4, Cxcr4

---

Tested Applications

• Positive FC detected in: mouse thymocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98233-1-RR targets CXCR4/CD184 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2231

  Product name: Recombinant Mouse CXCR4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 1-40 aa of NM_009911.3

  Sequence: MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNR

• Full Name: chemokine (C-X-C motif) receptor 4
• Calculated Molecular Weight: 40kDa
• GenBank Accession Number: NM_009911.3
• Gene Symbol: Cxcr4
• Gene ID (NCBI): 12767
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P70658
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

C-X-C chemokine receptor type 4 (CXCR4, also known as CD184) is a widely expressed G protein-coupled seven-transmembrane receptor. CXCL12/SDF-1 is the biological ligand for CXCR4. The binding of CXCL12 to CXCR4 induces intracellular signaling through several divergent pathways initiating signals related to chemotaxis, cell survival and/or proliferation, increase in intracellular calcium, and gene transcription (PMID: 20484021). CXCR4 also functions as a coreceptor for HIV-1 entry (PMID: 9427609).