Tested Applications
| Positive WB detected in | HeLa cells |
| Positive IHC detected in | human placenta tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 3 publications below |
Product Information
25708-1-AP targets KK-LC-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22619 Product name: Recombinant human CXorf61 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-113 aa of BC062223 Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST Predict reactive species |
| Full Name | chromosome X open reading frame 61 |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC062223 |
| Gene Symbol | KK-LC-1 |
| Gene ID (NCBI) | 203413 |
| RRID | AB_2880203 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5H943 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KK-LC-1 has been described as kita-kyushu lung cancer antigen 1, cancer/testis antigen 83. Therefore, KK-LC-1 is also known as CXorf61 and CT83. KK-LC-1 has been tested for association to diseases, such as adenocarcinoma and lung neoplasms. The molecular mass of KK-LC-1 is 13 kDa. Studies have shown that KK-LC-1 is an ideal target for immunotherapy of triple-negative breast cancer (TNBC) (PMID: 26327325).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for KK-LC-1 antibody 25708-1-AP | Download protocol |
| WB protocol for KK-LC-1 antibody 25708-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int Immunopharmacol Integrative analysis-based identification and validation of a prognostic immune cell infiltration-based model for patients with advanced gastric cancer. | ||
Cancer Immunol Immunother Integrating bulk and single-cell sequencing data to construct a Scissor+ dendritic cells prognostic model for predicting prognosis and immune responses in ESCC | ||
Nat Commun KK-LC-1 as a therapeutic target to eliminate ALDH+ stem cells in triple negative breast cancer |









