• Featured Product
  • KD/KO Validated

NOX2 Polyclonal antibody

NOX2 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA
Cat No. 19013-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), CoIP, ELISA

CYBB, CGD, CGD91-phox, Cytochrome b-245 heavy chain, EC:1.-.-.-

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJ774A.1 cells, human plasma, RAW 264.7 cells, mouse spleen tissue, rat spleen tissue
Positive IHC detected inmouse spleen tissue, human tonsillitis tissue, rat spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse spleen tissue, human tonsillitis tissue
Positive IF-Fro detected inmouse brain tissue
Positive FC (Intra) detected inRAW 264.7 cells, MCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19013-1-AP targets NOX2 in WB, IHC, IF-P, IF-Fro, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5536

Product name: Recombinant human CYBB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 418-570 aa of BC032720

Sequence: SILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

Predict reactive species
Full Name cytochrome b-245, beta polypeptide
Calculated Molecular Weight 577 aa, 65 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC032720
Gene Symbol NOX2
Gene ID (NCBI) 1536
RRIDAB_2833044
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04839
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOX2, also named as CYBB, CGD, 91-phox, gp91-1, gp91-phox, p22 phagocyte B-cytochrome, cytochrome b-245 and beta polypeptide, is a critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. This full length protein has three glycosylation sites. CYBB is found in human cardiomyocytes as multiple bands:the signal between 55 and 65 kDa is probably the unglycosylated protein, because the predicted molecular weight of unglycosylated CYBB protein is approximately 58 kDa(PMID: 17587483) to 65 kDa in phagocytes and the bands around 80 kDa probably represent glycosylated CYBB, as has also been shown in human umbilical vein endothelial cells(PMID:12610097). In other reports, it also can be detected a band of 91 kDa(PMID:19965781).

Protocols

Product Specific Protocols
FC protocol for NOX2 antibody 19013-1-APDownload protocol
IF protocol for NOX2 antibody 19013-1-APDownload protocol
IHC protocol for NOX2 antibody 19013-1-APDownload protocol
WB protocol for NOX2 antibody 19013-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB

Cell Host Microbe

Zinc promotes microbial p-coumaric acid production that protects against cholestatic liver injury

Authors - Dongping Li
mouseWB

Circulation

Megakaryocytic Leukemia 1 (MKL1) Bridges Epigenetic Activation of NADPH Oxidase in Macrophages to Cardiac Ischemia-Reperfusion Injury.

Authors - Yu Liming
mouseWB,IHC

Cell Host Microbe

Gut microbiome dysbiosis contributes to abdominal aortic aneurysm by promoting neutrophil extracellular trap formation

Authors - Zhenyu Tian
mouseWB

Brain Behav Immun

Adiponectin ameliorates traumatic brain injury-induced ferroptosis through AMPK- ACC1 signaling pathway

Authors - Yufeng Ge

Sci Adv

Sphingolipid biosynthesis is essential for metabolic rewiring during TH17 cell differentiation

Authors - Thiruvaimozhi Abimannan
humanWB,IF

Redox Biol

Silencing COX-2 blocks PDK1/TRAF4-induced AKT activation to inhibit fibrogenesis during skeletal muscle atrophy.

Authors - Hongtao Chen
Loading...
||
New chat

Able

正在加载,请稍候...