Product Information
51097-1-AP targets CYP302a1 (mosquito) in ELISA applications and shows reactivity with mosquito samples.
| Tested Reactivity | mosquito |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0761 Product name: Recombinant CYP302a1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-515 aa of AY947549 Sequence: MYLSPVKSKIKSATLMTSRSCATVVLENVKPYNQIPGPRGPFGLGNLYQYIPGIGKYSFDALHESGQDKYEKYGPIVRETMVPGQDIVWLYDPNDIAAVLNDKTPGIYPSRRSHTALAKYRRDRPNVYRTAGLLATNGIEWWKIRSELQKGLSSPQSVRNFLPLTDKVTREFVASMNSTEHDCVPDFMPAISRLNLELICVMAFDVRLDSFSDEQMKPNSLSSRLMESAEVTNQSILPTDQGFQLWKYFETPAYRKLRKAQEFMEKTAVELVSQKLLYFDEDQQKLASGRHRSRSLLEEYLRNPNLELHDIIGMAADLLLAGVHTSSYTTAFALYHLCLNPDAQDKLYQEACRILPDPWECQIEAAALNSEASYCRAVLKESLRLNPISIGVGRILNKDATLGGYHVPKGTVVVTQNLVSCRQERYFKNPTKFIPERWMRETKEDVNPYLVLPFGHGMRSCIARRMAEQNMLVLLLRLIRSYEIDWKGKVPMNIETKLINQPDQPIKIAFRSRKS Predict reactive species |
| Full Name | CYP302a1 (mosquito) |
| Calculated Molecular Weight | 59 kDa |
| GenBank Accession Number | AY947549 |
| Gene Symbol | |
| Gene ID (NCBI) | |
| RRID | AB_2881247 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CYP302a1, also named as disembodied (dib-Bm), belongs to the cytochrome P450 family. This antibody detects the CYP302a1 protein of mosquito.
