Caspase 1 Polyclonal antibody

• 

  WB analysis using 31020-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31020-1-AP (Casp1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Caspase 1 Polyclonal Antibody for WB, ELISA

Cat No. 31020-1-AP

Publications(20)

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

Casp1, m CASP1, mouse CASP1, mouse caspase 1, CASP 1

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 17 publications below
• IHC: See 4 publications below

Product Information

31020-1-AP targets Caspase 1 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34441

  Product name: Recombinant mouse Casp1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 119-296 aa of BC008152

  Sequence: DNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFK

• Full Name: caspase 1
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC008152
• Gene Symbol: Caspase 1
• Gene ID (NCBI): 12362
• RRID: AB_3669817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P29452
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). 31020-1-AP is designed for mouse caspase 1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Phytomedicine; ErTao decoction alleviates liver fibrosis by suppressing STING-mediated macrophages and NLRP3 inflammasome activation; Authors - Hui Jia
rat	WB	Heliyon; High-intensity interval training and moderate-intensity continuous training alleviate vascular dysfunction in spontaneously hypertensive rats through the inhibition of pyroptosis; Authors - Yongjian Li
mouse	WB	Physiol Res; Trimethylamine Induced Chronic Kidney Injury by Activating the ZBP1-NLRP3 Inflammasome Pathway; Authors - L Bai
human,rat	WB	Molecules; Structural Characterization and Anti-Gouty Nephropathy Potential of Polysaccharides from Atractylodes chinensis; Authors - Xue Chen
mouse	WB	J Cell Mol Med; p16INK4a Deletion Alleviated Obesity-Associated Kidney Fibrosis by Regulating Metabolic Reprogramming and the Inflammasome Pathway; Authors - Qian Liu
mouse	IHC	J Inflamm Res; The Onset of Systemic Lupus Erythematosus Triggers Nucleus Pulposus Cell Pyroptosis to Exacerbate Intervertebral Disc Degeneration; Authors - Zhaobai Lao