• Featured Product
  • KD/KO Validated

Caspase 6 Monoclonal antibody, PBS Only

Caspase 6 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 67825-1-PBS
Clone No.1H7F9

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Apoptotic protease Mch 2, CASP 6, CASP6, Caspase 6, Caspase6, MCH2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67825-1-PBS targets Caspase 6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20534

Product name: Recombinant human Caspase 6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 59-222 aa of BC000305

Sequence: LTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRET

Predict reactive species
Full Name caspase 6, apoptosis-related cysteine peptidase
Calculated Molecular Weight 33 kDa, 22 kDa
Observed Molecular Weight 33-35 kDa,22kDa, 18kDa
GenBank Accession NumberBC000305
Gene Symbol Caspase 6
Gene ID (NCBI) 839
RRIDAB_2918587
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55212
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Caspase-6 belongs to caspase family of cysteinyl-aspartate specific proteases.Precursor of CASP6 produces two subunits, large (18kDa) and small (16kDa) that dimerize. It cleaves poly(ADP-ribose) polymerase, as well as lamins and is involved in the activation cascade of caspases responsible for apoptosis execution. Researches showed that CASP6 could be an early instigator of neuronal dysfunction and regulates B cell activation and differentiation into plasma cells by modifying cell cycle entry. IRAK3 is an important target for CASP6. It can reveal five bands of 28, 32, 36, 49, and 64 kDa in human neurons and fetal brain in western blot, the 32 and 28 kDa bands represent procaspase-6 and pro-arm caspase-6. Procaspase-6 is more abundant than pro-arm caspase-6 in adult tissue, whereas pro-arm caspase-6 is more abundant than pro-caspase-6 in fetal brain and cultured neurons. The higher molecular mass bands at 49 and 64 kDa likely represent dimers of p28 and p32.(PMID:10438520). In rat testis, it can be detected two bands of 34 kDa and 12 kDa or 14 kDa(PMID:12538628).

Loading...
||
New chat

Able

正在加载,请稍候...