Caspr2/CNTNAP2 Recombinant monoclonal antibody, PBS Only

Caspr2/CNTNAP2 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 85116-4-PBS
Clone No.242391A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

CNTNAP2, 242391A9, CASPR2, Contactin-associated protein-like 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85116-4-PBS targets Caspr2/CNTNAP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag22844

Product name: Recombinant human CNTNAP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 982-1331 aa of BC113373

Sequence: ERYHGYSCDCSNTAYDGTFCNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPSSSDTLFNSPKSLFLGKVIETGKIDQEIHKYNTPGFTGCLSRVQFNQIAPLKAALRQTNASAHVHIQGELVESNCGASPLTLSPMSSATDPWHLDHLDSASADFPYNPGQGQAIRNGVNRNSAIIGGVIAVVIFTILCTLVFLIRYMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFTETIDESKKEWLI

Predict reactive species
Full Name contactin associated protein-like 2
Calculated Molecular Weight 1331 aa, 148 kDa
Observed Molecular Weight148 kDa
GenBank Accession NumberBC113373
Gene Symbol Grancalcin
Gene ID (NCBI) 26047
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UHC6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Caspr2 is a member of the neurexin family which functions in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, thrombospondin N-terminal-like domains and a putative PDZ binding site. This protein is localized at the juxtaparanodes of myelinated axons, and mediates interactions between neurons and glia during nervous system development and is also involved in localization of potassium channels within differentiating axons. This gene encompasses almost 1.5% of chromosome 7 and is one of the largest genes in the human genome. It is directly bound and regulated by forkhead box protein P2, a transcription factor related to speech and language development.

Loading...
||
New chat Able
正在加载,请稍候...