Mouse Cd300lg Recombinant monoclonal antibody, PBS Only (Detector)

Cd300lg Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 85624-1-PBS
Clone No.242032H3

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Indirect ELISA

CD300 antigen-like family member G, CD300g, Clm9, CLM-9, CMRF35-like molecule 9

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85624-1-PBS targets Cd300lg as part of a matched antibody pair:

MP01979-2: 85624-3-PBS capture and 85624-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2731

Product name: Recombinant Mouse CD300LG protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 19-284 aa of NM_001160712.1

Sequence: LKGPKEISGFEGDTVSLRCTYVEKMKEHRKYWCRQGGILVSRCGDIVYANQDQEVTRGRMSIRDSPQELSMTVIMRDLTLKDSGKYWCGIDRLGRDESFEVTLIVFPGKRDNAVPAGTCCPSSPTPSFQPLTPTRSLQPKAKAWQTQLPEPTSPGLHPTVVTAKQGKTGVKAPVFTEVAPAWSTGTSQVPPGISPYAGSSPHTATPARSAGTSQVPPGISPYAGRSPHTATSPHAGSSRPVVWLPLTTPQDSRAVASSVSKPSVSI

Predict reactive species
Full Name CD300 antigen like family member G
Calculated Molecular Weight37 kDa
GenBank Accession NumberNM_001160712.1
Gene Symbol Cd300lg
Gene ID (NCBI) 52685
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDNP_001154183.1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat

Able

正在加载,请稍候...