CD31 Polyclonal antibody

• 

  WB analysis of bEnd.3 using 28083-1-AP

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 28083-1-AP (CD31 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 28083-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 28083-1-AP (CD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 28083-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 28083-1-AP (CD31 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 28083-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28083-1-AP (CD31 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 28083-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28083-1-AP (CD31 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 28083-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28083-1-AP (Cd31 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 28083-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 28083-1-AP (Cd31 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 28083-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28083-1-AP (CD31 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28083-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28083-1-AP (CD31 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28083-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28083-1-AP (CD31 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 28083-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CD31 antibody (28083-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse kidney using 28083-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using CD31 antibody (28083-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse kidney using 28083-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using CD31 antibody (28083-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 28083-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CD31 antibody (28083-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 28083-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CD31 antibody (28083-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 28083-1-AP

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using CD31 antibody (28083-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

CD31 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA

Cat No. 28083-1-AP

Publications(117)

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (1)

Applications

WB, IHC, IF-P, IF-Fro, ELISA

Synonyms

Pecam, PECAM 1, Pecam1, PECAM-1

---

Tested Applications

• Positive WB detected in: bEnd.3 cells, mouse liver tissue, mouse spleen tissue
• Positive IHC detected in: mouse liver tissue, mouse brain tissue, mouse kidney tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue, mouse kidney tissue
• Positive IF-Fro detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:4000-1:16000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 17 publications below
• IHC: See 43 publications below
• IF: See 59 publications below

Product Information

28083-1-AP targets CD31 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27828

  Product name: Recombinant mouse Pecam1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 51-276 aa of NM_001032378

  Sequence: MISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSE

• Full Name: platelet/endothelial cell adhesion molecule 1
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 110-130 kDa
• GenBank Accession Number: NM_001032378
• Gene Symbol: CD31
• Gene ID (NCBI): 18613
• RRID: AB_2881055
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08481
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Nanomicro Lett; Gelatin-Based Metamaterial Hydrogel Films with High Conformality for Ultra-Soft Tissue Monitoring; Authors - Yuewei Chen
mouse		Cell Mol Biol Lett; Robo4 inhibits gamma radiation-induced permeability of a murine microvascular endothelial cell by regulating the junctions; Authors - Seyram Yao Adzraku
mouse	IHC	Front Immunol; Integrated analysis reveals crosstalk between pyroptosis and immune regulation in renal fibrosis; Authors - Fengxia Bai
mouse	IF	Cells; Dental Pulp Cell Transplantation Combined with Regenerative Endodontic Procedures Promotes Dentin Matrix Formation in Mature Mouse Molars; Authors - Jorge Luis Montenegro Raudales
mouse	IF	J Ethnopharmacol; The mechanism of Chebulae Fructus Immaturus promote diabetic wound healing based on network pharmacology and experimental verification; Authors - Feng Qiu
mouse	IF	Front Immunol; "γδT Cell-IL17A-Neutrophil" Axis Drives Immunosuppression and Confers Breast Cancer Resistance to High-Dose Anti-VEGFR2 Therapy.; Authors - Zhigang Zhang