Use Able AI chat for product recommendations

CD31 Polyclonal antibody

CD31 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA

Cat No. 28083-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (1)

Applications

WB, IHC, IF-P, IF-Fro, ELISA

Pecam, PECAM 1, Pecam1, PECAM-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inbEnd.3 cells, mouse liver tissue, mouse spleen tissue
Positive IHC detected inmouse liver tissue, mouse brain tissue, mouse kidney tissue, mouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue, mouse kidney tissue
Positive IF-Fro detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28083-1-AP targets CD31 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27828

Product name: Recombinant mouse Pecam1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 51-276 aa of NM_001032378

Sequence: MISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSE

Predict reactive species
Full Name platelet/endothelial cell adhesion molecule 1
Calculated Molecular Weight 81 kDa
Observed Molecular Weight 110-130 kDa
GenBank Accession NumberNM_001032378
Gene Symbol CD31
Gene ID (NCBI) 18613
RRIDAB_2881055
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ08481
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).

Protocols

Product Specific Protocols
IF protocol for CD31 antibody 28083-1-APDownload protocol
IHC protocol for CD31 antibody 28083-1-APDownload protocol
WB protocol for CD31 antibody 28083-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Cell

Peripheral cancer attenuates amyloid pathology in Alzheimer's disease via cystatin-c activation of TREM2.

Authors - Xinyan Li
humanIHC

Mol Cancer

circNOX4 activates an inflammatory fibroblast niche to promote tumor growth and metastasis in NSCLC via FAP/IL-6 axis

Authors - Yan Zhao
IHC

Nanomicro Lett

Gelatin-Based Metamaterial Hydrogel Films with High Conformality for Ultra-Soft Tissue Monitoring

Authors - Yuewei Chen
IF

Adv Mater

Spatiotemporally Programming Microenvironment to Recapitulate Endochondral Ossification via Greenhouse-Inspired Bionic Niche

Authors - Xuzheng Liu

Bioact Mater

Perivascular administration of metformin through 3D minichannels improved adventitia ingrowth and endothelialization for electrospinning vascular grafts.

Authors - Yidong Hu
mouseIF

Bioact Mater

Immunomodulatory copper-based polyphenol nanozyme for diabetic infectious wound healing via NIR amplified cuproptosis bacteriostat in synergy with ferroptosis inhibition anti-inflammation.

Authors - Huyang Gao

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Georgia (Verified Customer) (11-27-2025)

Corpus callosum samples subject to western blotting with CD31 antibody at a dilution of 1:2000 incubated at room temperature for 2 hours.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Corpus Callosum mouse brain
Loading...
||
New chat

Able

正在加载,请稍候...