CXCL12/SDF-1 Polyclonal antibody

• 

Cxcl12 Polyclonal Antibody for ELISA

Cat No. 51091-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

IHC, IF, ELISA

Synonyms

AI174028, Cxcl12, PBSF, PBSF/SDF 1, Scyb12, SDF 1, Sdf1, Sdf1a, Sdf1b, TLSF, TLSF a, TLSF b, TPAR1

---

Published Applications

• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

51091-1-AP targets Cxcl12 in IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rabbit
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0474

  Product name: Recombinant mouse Cxcl12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC020297

  Sequence: MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

• Full Name: chemokine (C-X-C motif) ligand 12
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: BC020297
• Gene Symbol: Cxcl12
• Gene ID (NCBI): 20315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40224
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Transl Oncol; Retinoic acid-loaded PLGA nanocarriers targeting cell cholesterol potentialize the antitumour effect of PD-L1 antibody by preventing epithelial-mesenchymal transition mediated by M2-TAM in colorectal cancer; Authors - Raimundo Fernandes de Araújo Júnior
rabbit	IF	Cells; Efficacy of Rectal Systemic Administration of Mesenchymal Stem Cells to Injury Sites via the CXCL12/CXCR4 Axis to Promote Regeneration in a Rabbit Skeletal Muscle Injury Model; Authors - Toru Ichiseki
human	IHC	Clin Exp Med; Fibroblast expression of neurotransmitter receptor HTR2A associates with inflammation in rheumatoid arthritis joint; Authors - Chunyan Xiang