Cyclophilin A Monoclonal antibody, PBS Only

• 

  WB analysis using 67880-1-Ig (same clone as 67880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67880-1-Ig (CYPA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67880-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67880-1-Ig (same clone as 67880-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67880-1-Ig (CYPA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67880-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67880-1-Ig (same clone as 67880-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Cyclophilin A antibody (67880-1-Ig, Clone: 2B11B9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67880-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67880-1-Ig (same clone as 67880-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human Cyclophilin A (67880-1-Ig, Clone:2B11B9) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67880-1-PBS in a different storage buffer formulation.

Cyclophilin A Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 67880-1-PBS

Clone No.2B11B9

Host / Isotype

Mouse / IgG1

Reactivity

rat, mouse, human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

PPIA, EC:5.2.1.8, CYPH, CYPA, Cyclosporin A-binding protein

---

Product Information

67880-1-PBS targets Cyclophilin A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with rat, mouse, human samples.

• Tested Reactivity: rat, mouse, human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1120

  Product name: Recombinant human CYPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC005320

  Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

• Full Name: peptidylprolyl isomerase A (cyclophilin A)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC005320
• Gene Symbol: PPIA
• Gene ID (NCBI): 5478
• RRID: AB_2918637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P62937
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclophilin A, also named as PPIA and Rotamase A, belongs to the cyclophilin-type PPIase family and PPIase A subfamily. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. PPIA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication.