Cyclophilin A Monoclonal antibody

• 

  WB analysis using 67880-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67880-1-Ig (CYPA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis using 67880-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67880-1-Ig (CYPA antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 67880-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Cyclophilin A antibody (67880-1-Ig, Clone: 2B11B9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  FC experiment of HeLa using 67880-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human Cyclophilin A (67880-1-Ig, Clone:2B11B9) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Cyclophilin A Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 67880-1-Ig

Clone No.2B11B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

PPIA, EC:5.2.1.8, CYPH, CYPA, Cyclosporin A-binding protein

---

Tested Applications

• Positive WB detected in: HepG2 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67880-1-Ig targets Cyclophilin A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1120

  Product name: Recombinant human CYPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC005320

  Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

• Full Name: peptidylprolyl isomerase A (cyclophilin A)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC005320
• Gene Symbol: PPIA
• Gene ID (NCBI): 5478
• RRID: AB_2918637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P62937
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclophilin A, also named as PPIA and Rotamase A, belongs to the cyclophilin-type PPIase family and PPIase A subfamily. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. PPIA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication.