Tested Applications
Positive WB detected in | HeLa cells, human heart tissue, human skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, HEK-293 cells, HepG2 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, ROS1728 cells, RAW 264.7 cells |
Positive IHC detected in | human liver cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:5000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 119 publications below |
IHC | See 3 publications below |
IF | See 17 publications below |
Product Information
66264-1-Ig targets Cytochrome c in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, canine |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24349 Product name: Recombinant human Cytochrome c protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-105 aa of BC009578 Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE Predict reactive species |
Full Name | cytochrome c, somatic |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 12-15 kDa |
GenBank Accession Number | BC009578 |
Gene Symbol | Cytochrome c |
Gene ID (NCBI) | 54205 |
RRID | AB_2716798 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P99999 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, resulting in caspase-3 activation and apoptosis. Measurement of cytochrome c release from the mitochondria is useful for detection of the onset of apoptosis in cells. In addition, cytochrome c can also leave cells and be detectable in extra-cellular medium of apoptotic cells and serum of cancer patients. The level of serum cytochrome c may serve as a prognostic maker during cancer therapy.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Cytochrome c antibody 66264-1-Ig | Download protocol |
IHC protocol for Cytochrome c antibody 66264-1-Ig | Download protocol |
IF protocol for Cytochrome c antibody 66264-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Hepatology Hepatic stimulator substance resists hepatic ischemia/reperfusion injury by regulating Drp1 translocation and activation. | ||
Cell Death Differ ZNF451 collaborates with RNF8 to regulate RNF168 localization and amplify ubiquitination signaling to promote DNA damage repair and regulate radiosensitivity | ||
Nat Commun Endonuclease G promotes autophagy by suppressing mTOR signaling and activating the DNA damage response. | ||
Redox Biol Mecheliolide elicits ROS-mediated ERS driven immunogenic cell death in hepatocellular carcinoma. | ||
ACS Appl Mater Interfaces Extracellular Matrix-Mimicking Hydrogel with Angiogenic and Immunomodulatory Properties Accelerates Healing of Diabetic Wounds by Promoting Autophagy | ||
J. Pineal Res. Human transporters, PEPT1/2, facilitate melatonin transportation into mitochondria of cancer cells: an implication of the therapeutic potential. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Megha (Verified Customer) (07-10-2018) |
|