CoraLite® Plus 488-conjugated Cytochrome c Monoclonal antibody

• 

  IF Staining of A431 using CL488-66264

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 Cytochrome c antibody (CL488-66264, Clone: 2D8D11 ) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

Cytochrome c Monoclonal Antibody for IF/ICC

Cat No. CL488-66264

Clone No.2D8D11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

2D8D11, CYC, CYCS

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66264 targets Cytochrome c in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24349

  Product name: Recombinant human Cytochrome c protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-105 aa of BC009578

  Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

• Full Name: cytochrome c, somatic
• Calculated Molecular Weight: 12 kDa
• GenBank Accession Number: BC009578
• Gene Symbol: Cytochrome c
• Gene ID (NCBI): 54205
• RRID: AB_2883297
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P99999
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, resulting in caspase-3 activation and apoptosis. Measurement of cytochrome c release from the mitochondria is useful for detection of the onset of apoptosis in cells. In addition, cytochrome c can also leave cells and be detectable in extra-cellular medium of apoptotic cells and serum of cancer patients. The level of serum cytochrome c may serve as a prognostic maker during cancer therapy.