• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Cytohesin 2 Monoclonal antibody

Cytohesin 2 Monoclonal Antibody for IF/ICC
Cat No. CL594-67185
Clone No.3A7A1

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

IF/ICC

ARF exchange factor, ARNO, CTS18, CTS18.1, CYTH2, cytohesin 2, Protein ARNO, PSCD2, PSCD2L, SEC7L, Sec7p L, Sec7p like

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67185 targets Cytohesin 2 in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21279

Product name: Recombinant human CYTH2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 130-384 aa of BC004361

Sequence: VDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEML

Predict reactive species
Full Name cytohesin 2
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC004361
Gene Symbol Cytohesin 2
Gene ID (NCBI) 9266
RRIDAB_2883644
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99418
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Pleckstrin homology, Sec7 and coiled/coil domains 2 (PSCD2) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. PSCD2 exhibits GEP activity in vitro with small G proteins ARF1, ARF3, and ARF6.

Protocols

Product Specific Protocols
IF protocol for CL594 Cytohesin 2 antibody CL594-67185Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...