Cytokeratin 13 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of A431 using 83058-4-RR (same clone as 83058-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using Cytokeratin 13 antibody (83058-4-RR, Clone: 230366E8 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83058-4-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 83058-4-RR (same clone as 83058-4-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug Anti-Human KRT13 (83058-4-RR, Clone:230366E8) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83058-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83058-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83058-4-RR against Human Cytokeratin 13 were performed. The affinity constant is 1.65 nM.

Cytokeratin 13 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83058-4-PBS

Clone No.230366E8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

KRT13, 230366E8, CK 13, CK13, CK-13

---

Product Information

83058-4-PBS targets Cytokeratin 13 in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0217

  Product name: Recombinant human KRT13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-458 aa of BC002661

  Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP

• Full Name: keratin 13
• Calculated Molecular Weight: 50 kDa
• GenBank Accession Number: BC002661
• Gene Symbol: Cytokeratin 13
• Gene ID (NCBI): 3860
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13646
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Keratin 13 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in keratin 13 gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2.