- Home
- Products
- Primary Antibodies
- Cytokeratin 5 Monoclonal antibody, PBS Only (66727-1-PBS)
Proteintech Guarantee
The Proteintech guarantee covers Proteintech antibodies in any species and any application, including those not listed on the datasheet. If the antibody doesn’t perform, you can receive a hassle-free refund or credit note.
WB analysis using 66727-1-Ig (same clone as 66727-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Various lysates were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
WB analysis of mouse skin using 66727-1-Ig (same clone as 66727-1-PBS)
mouse skin tissue were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× mouse skin tissue were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
WB analysis of SKOV-3 using 66727-1-Ig (same clone as 66727-1-PBS)
SKOV-3 cells were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× SKOV-3 cells were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 66727-1-Ig (same clone as 66727-1-PBS)
MCF-7 cells were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× MCF-7 cells were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 66727-1-Ig (same clone as 66727-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× A549 cells were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
WB analysis of mouse skin using 66727-1-Ig (same clone as 66727-1-PBS)
mouse skin tissue were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× mouse skin tissue were subjected to SDS PAGE followed by western blot with 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:3000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:3000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:3000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:3000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast hyperplasia using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast hyperplasia using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast hyperplasia using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast hyperplasia using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast hyperplasia tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human skin cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 10x lens) showing negative staining. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 10x lens) showing negative staining. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 66727-1-Ig (same clone as 66727-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 40x lens) showing negative staining. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66727-1-Ig (Cytokeratin 5 antibody) at dilution of 1:10000 (under 40x lens) showing negative staining. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of human oesophagus cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of human oesophagus cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of human prostate cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of human oesophagus cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of human oesophagus cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed human oesophagus cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of human prostate cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of human lung cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of human lung cancer using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human lung cancer tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of mouse eye using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of mouse eye using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
IF Staining of A431 using 66727-1-Ig (same clone as 66727-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy× Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using Cytokeratin 5 antibody (66727-1-Ig, Clone: 1A1C5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66727-1-PBS in a different storage buffer formulation.
Product Information
66727-1-PBS targets Cytokeratin 5 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples.
| Tested Reactivity | human, mouse, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24184 Product name: Recombinant human KRT5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 316-491 aa of BC024292 Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI Predict reactive species |
| Full Name | keratin 5 |
| Calculated Molecular Weight | 590 aa, 62 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC024292 |
| Gene Symbol | Cytokeratin 5 |
| Gene ID (NCBI) | 3852 |
| RRID | AB_2882077 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P13647 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells. Keratin expression is highly regulated, tissue specific, and varies according to cell-state. Type I keratins consist of acidic, low molecular weight proteins with MW ranging from 40 kDa (KRT19) to 64 kDa (KRT9). Type 2 keratins consist of basic or neutral, high molecular weight proteins with MW from 52 kDa (KRT8) to 67 kDa (KRT18). Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD keratin 14 in stratified squamous epithelia. Keratin 5, one 58-kD type II keratin, is coexpressed with a 50-kD tyK14 in stratified squamous epithelia.
