Cytokeratin 6A Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of A431 using 66685-1-Ig (same clone as 66685-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 66685-1-Ig (KRT6A antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66685-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66685-1-Ig (same clone as 66685-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66685-1-Ig (Cytokeratin 6A antibody) at dilution of 1:10000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66685-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66685-1-Ig (same clone as 66685-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66685-1-Ig (Cytokeratin 6A antibody) at dilution of 1:10000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66685-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 66685-1-Ig (same clone as 66685-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66685-1-Ig (Cytokeratin 6A antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66685-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 66685-1-Ig (same clone as 66685-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66685-1-Ig (Cytokeratin 6A antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66685-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50382-1

  Cytometric bead array standard curve of MP50382-1, KRT6A Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66685-1-PBS. Detection antibody: 68294-2-PBS. Standard:Ag0882. Range: 0.098-100 ng/mL.

Cytokeratin 6A Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 66685-1-PBS

Clone No.2H6A11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

Cytokeratin 6, KRT6A, 2H6A11, CK 6A, CK6

---

Product Information

66685-1-PBS targets Cytokeratin 6A as part of a matched antibody pair:

MP50382-1: 66685-1-PBS capture and 68294-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0882

  Product name: Recombinant human KRT6A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 364-564 aa of BC008807

  Sequence: QVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH

• Full Name: keratin 6A
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC008807
• Gene Symbol: Cytokeratin 6A
• Gene ID (NCBI): 3853
• RRID: AB_2882039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P02538
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 6 is a type II keratin. It is used as marker for epidermal hyperproliferation and differentiation. Three are three keratin 6 isoforms: ketatin 6A, 6B and 6C. They share more than 99% identical DNA sequence.