Cytokeratin 6A Monoclonal antibody, PBS Only (Capture)

Cytokeratin 6A Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 66685-1-PBS
Clone No.2H6A11

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Cytokeratin 6, KRT6A, 2H6A11, CK 6A, CK6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66685-1-PBS targets Cytokeratin 6A as part of a matched antibody pair:

MP50382-1: 66685-1-PBS capture and 68294-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0882

Product name: Recombinant human KRT6A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 364-564 aa of BC008807

Sequence: QVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH

Predict reactive species
Full Name keratin 6A
Calculated Molecular Weight 60 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC008807
Gene Symbol Cytokeratin 6A
Gene ID (NCBI) 3853
RRIDAB_2882039
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02538
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 6 is a type II keratin. It is used as marker for epidermal hyperproliferation and differentiation. Three are three keratin 6 isoforms: ketatin 6A, 6B and 6C. They share more than 99% identical DNA sequence.

Loading...
||
New chat Able
正在加载,请稍候...