Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue, Transfected HEK-293 cells |
| Positive IHC detected in | mouse heart tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
Product Information
25206-1-AP targets DAAM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18955 Product name: Recombinant human DAAM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4-55 aa of BC128388 Sequence: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAEL Predict reactive species |
| Full Name | dishevelled associated activator of morphogenesis 2 |
| Calculated Molecular Weight | 1068 aa, 123 kDa |
| Observed Molecular Weight | 100-130 kDa |
| GenBank Accession Number | BC128388 |
| Gene Symbol | DAAM2 |
| Gene ID (NCBI) | 23500 |
| RRID | AB_2879959 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86T65 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DAAM2 antibody 25206-1-AP | Download protocol |
| IHC protocol for DAAM2 antibody 25206-1-AP | Download protocol |
| WB protocol for DAAM2 antibody 25206-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Mol Biosci Dishevelled-Associated Activator of Morphogenesis 2 (DAAM2) Predicts the Immuno-Hot Phenotype in Pancreatic Adenocarcinoma. | ||
Clin Transl Oncol The prognostic value of DAAM2 in lower grade glioma, liver cancer, and breast cancer
| ||
Adv Healthc Mater A Highly Bioactive Organic-Inorganic Nanoparticle for Activating Wnt10b Mediated Osteogenesis by Specifically Anchor CCN3 Protein | ||
Clin Immunol Formin protein DIAPH1 positively regulates PD-L1 expression and predicts the therapeutic response to anti-PD-1/PD-L1 immunotherapy |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Erithelgi (Verified Customer) (11-11-2019) | The antibody was verified in an siRNA mediated knockdown
|















