Tested Applications
Positive WB detected in | mouse brain tissue, rat brain tissue, Transfected HEK-293 cells |
Positive IHC detected in | mouse heart tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IHC | See 3 publications below |
IF | See 1 publications below |
Product Information
25206-1-AP targets DAAM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18955 Product name: Recombinant human DAAM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4-55 aa of BC128388 Sequence: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAEL Predict reactive species |
Full Name | dishevelled associated activator of morphogenesis 2 |
Calculated Molecular Weight | 1068 aa, 123 kDa |
Observed Molecular Weight | 100-130 kDa |
GenBank Accession Number | BC128388 |
Gene Symbol | DAAM2 |
Gene ID (NCBI) | 23500 |
RRID | AB_2879959 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q86T65 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DAAM2 antibody 25206-1-AP | Download protocol |
IHC protocol for DAAM2 antibody 25206-1-AP | Download protocol |
IF protocol for DAAM2 antibody 25206-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Mol Biosci Dishevelled-Associated Activator of Morphogenesis 2 (DAAM2) Predicts the Immuno-Hot Phenotype in Pancreatic Adenocarcinoma. | ||
Clin Transl Oncol The prognostic value of DAAM2 in lower grade glioma, liver cancer, and breast cancer
| ||
Adv Healthc Mater A Highly Bioactive Organic-Inorganic Nanoparticle for Activating Wnt10b Mediated Osteogenesis by Specifically Anchor CCN3 Protein | ||
Clin Immunol Formin protein DIAPH1 positively regulates PD-L1 expression and predicts the therapeutic response to anti-PD-1/PD-L1 immunotherapy |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Erithelgi (Verified Customer) (11-11-2019) | The antibody was verified in an siRNA mediated knockdown
|