DAAM2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DAAM2 Polyclonal antibody (25206-1-AP)

• Featured Product
• KD/KO Validated

DAAM2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25206-1-AP Copied!

Publications (5)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

DAAM2, KIAA0381

• 

  WB analysis of mouse brain using 25206-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25206-1-AP (DAAM2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 25206-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25206-1-AP (DAAM2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Transfected HEK-293 using 25206-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 25206-1-AP (DAAM2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 25206-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25206-1-AP (DAAM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 25206-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25206-1-AP (DAAM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 25206-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 25206-1-AP (DAAM2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 25206-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 25206-1-AP (DAAM2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 25206-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DAAM2 antibody (25206-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DAAM2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, Transfected HEK-293 cells
• Positive IHC detected in: mouse heart tissue, human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25206-1-AP targets DAAM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18955

  Product name: Recombinant human DAAM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-55 aa of BC128388

  Sequence: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAEL

• Full Name: dishevelled associated activator of morphogenesis 2
• Calculated Molecular Weight: 1068 aa, 123 kDa
• Observed Molecular Weight: 100-130 kDa
• GenBank Accession Number: BC128388
• Gene Symbol: DAAM2
• Gene ID (NCBI): 23500
• RRID: AB_2879959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86T65
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

25206-1-AP is a DAAM2 polyclonal antibody with 5 total citations. These appear in Advanced Healthcare Materials, Frontiers in Molecular Biosciences, Clinical Immunology, Clinical and Translational Oncology, and Journal of Ethnopharmacology. The associated research fields span osteogenesis via Wnt signaling, pancreatic adenocarcinoma immunophenotyping, PD-L1 expression and immunotherapy response, prognostic value in glioma/liver/breast cancer, and chronic kidney disease–mineral and bone disorder.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Adv Healthc Mater; A Highly Bioactive Organic-Inorganic Nanoparticle for Activating Wnt10b Mediated Osteogenesis by Specifically Anchor CCN3 Protein; Authors - Yonghao Qiu
human	WB,IHC	Front Mol Biosci; Dishevelled-Associated Activator of Morphogenesis 2 (DAAM2) Predicts the Immuno-Hot Phenotype in Pancreatic Adenocarcinoma.; Authors - Qinglin Zhang
mouse	IHC	Clin Immunol; Formin protein DIAPH1 positively regulates PD-L1 expression and predicts the therapeutic response to anti-PD-1/PD-L1 immunotherapy; Authors - Jie Mei
human	IHC,WB	Clin Transl Oncol; The prognostic value of DAAM2 in lower grade glioma, liver cancer, and breast cancer; Authors - Zeying Li ; KD Validated
		J Ethnopharmacol; Shenqi Yanshen Decoction protects against renal and bone injury in chronic kidney disease-mineral and bone disorder with potential involvement of Wnt5a/RhoA/Pkn3 signaling.; Authors - Xiaoqiong Zhang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

This product has one verified review with a 5-star rating. The reviewer used it on U2OS osteosarcoma cells for Western Blot at a 1:1000 dilution and confirmed the antibody's performance through siRNA-mediated knockdown validation. Overall, the feedback is positive, indicating reliable specificity and functional verification in the tested application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Erithelgi (Verified Customer) (11-11-2019)

The antibody was verified in an siRNA mediated knockdown

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: U2OS osteosarcoma cells