Tested Applications
| Positive WB detected in | Jurkat cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
27237-1-AP targets DACT1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26096 Product name: Recombinant human DACT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 601-700 aa of NM_001079520 Sequence: VREKTRAGSKKCRFPDDLDTNKKLKKASSKGRKSGGGPEAGVPGRPAGGGHRAGSRAHGHGREAVVAKPKHKRTDYRRWKSSAEISYEEALRRARRGRRE Predict reactive species |
| Full Name | dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis) |
| Calculated Molecular Weight | 90 kDa |
| Observed Molecular Weight | 90-100 kDa |
| GenBank Accession Number | NM_001079520 |
| Gene Symbol | DACT1 |
| Gene ID (NCBI) | 51339 |
| RRID | AB_3085940 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYF0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DACT1 (Dapper/Frodo) is a member of the Dapper family, which includes three genes: DACT1, DACT2 and DACT3. As a tumor suppressor, DACT1 is downregulated in multiple tumor types, such as liver, colon and breast cancer . DACT1 is an important modulator of Wnt signaling, interacting with key components of the various Wnt transduction pathways. For instance, DACT1 binds to disheveled homolog 1 (Dvl1) to induce the degradation of Dvl1 and the subsequent inhibition of the Wnt/β-catenin pathway . (PMID: 34252542, PMID: 29456669)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for DACT1 antibody 27237-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biochem Pharmacol SMURF1 leads to the β-catenin signaling-mediated progression of esophageal squamous carcinoma by losing PATZ1-induced CCNG2 transcription | ||
Transl Androl Urol Levosimendan in rats decreases acute kidney injury after cardiopulmonary resuscitation by improving mitochondrial dysfunction |

