DAZL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86344-3-RR (same clone as 86344-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86344-3-RR (DAZL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86344-3-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse testis using 86344-3-RR (same clone as 86344-3-PBS)

  IP result of anti-DAZL (IP:86344-3-RR, 4ug; Detection:86344-3-RR 1:600) with mouse testis tissue lysate 1680 ug. This data was developed using the same antibody clone with 86344-3-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 86344-3-RR (same clone as 86344-3-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 86344-3-RR (DAZL antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86344-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 86344-3-RR (same clone as 86344-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 86344-3-RR (DAZL antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86344-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 86344-3-RR (same clone as 86344-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 86344-3-RR (DAZL antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86344-3-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 86344-3-RR (same clone as 86344-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using DAZL antibody (86344-3-RR, Clone: 251035E11 ) at dilution of 1:2000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86344-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86344-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86344-3-RR against Human DAZL were performed. The affinity constant is 2.52 nM.

DAZL Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 86344-3-PBS

Clone No.251035E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

DAZH, DAZL1, DAZLA, DAZ-like autosomal, Deleted in azoospermia-like

---

Product Information

86344-3-PBS targets DAZL in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag37074

  Product name: Recombinant human DAZL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-295 aa of BC027595

  Sequence: QRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV

• Full Name: deleted in azoospermia-like
• Calculated Molecular Weight: 295 aa, 33 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC027595
• Gene Symbol: DAZL
• Gene ID (NCBI): 1618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92904
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DAZL proteins are germ cell-specific RNA-binding proteins and are considered major regulators of spermatogenesis. Because DAZL is a novel protein expressed specifically in germ cells, it is widely employed as a germ cell marker. In humans, immunostaining shows DAZL is abundant in the cytoplasm of primary spermatocytes, but scarce in spermatogonia.