DCBLD1 Polyclonal antibody

• 

  IHC staining of mouse lung using 24504-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24504-1-AP (DCBLD1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 24504-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 24504-1-AP (DCBLD1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DCBLD1 Polyclonal Antibody for IHC, ELISA

Cat No. 24504-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

Discoidin, CUB and LCCL domain-containing protein 1

---

Tested Applications

• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24504-1-AP targets DCBLD1 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21352

  Product name: Recombinant human DCBLD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 240-317 aa of BC035671

  Sequence: DGSLSDKRFLFTSNGCSRSLSFEPDGQIRASSSWQSVNESGDQVHWSPGQARLQDQGPSWASGDSSNNHKPREWLEID

• Full Name: discoidin, CUB and LCCL domain containing 1
• Calculated Molecular Weight: 715 aa, 78 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC035671
• Gene Symbol: DCBLD1
• Gene ID (NCBI): 285761
• RRID: AB_3085737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8Z6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCBLD1, a transmembrane protein with extracellular CUB (an extracellular domain of approximately 110 residues that is found in functionally diverse, mostly developmentally regulated proteins), LCCL (including 94-97 amino acids, non-cytoplasmic but the function is undefined), and F5/8 type C domains 8, is a type I transmembrane protein (A-D) that binds to semaphorins, belonging to the DCBLD family, and is rarely studied and poorly characterized.