DCHS2 Polyclonal antibody

• 

  WB analysis using 31631-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31631-1-AP (DCHS2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31631-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31631-1-AP (DCHS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

DCHS2 Polyclonal Antibody for WB, ELISA

Cat No. 31631-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Cadherin 27, Cadherin like protein CDHJ, Cadherin like protein VR8, CDH27, CDHJ

---

Tested Applications

• Positive WB detected in: U-251 cells, U-118 MG cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31631-1-AP targets DCHS2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35080

  Product name: Recombinant human DCHS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2500-2600 aa of NM_001358235

  Sequence: IFTISPVLLLDTISTTQFLVEASDGGNPDLRALTLVEIGIEDMNNYAPEFTVKSYNLSLSEDALVGSTLVTFSNIDHDWTRENTYVEYSIISGNSQNNFHV

• Full Name: dachsous 2 (Drosophila)
• Calculated Molecular Weight: 370 kDa
• Observed Molecular Weight: ~75 kDa
• GenBank Accession Number: NM_001358235
• Gene Symbol: DCHS2
• Gene ID (NCBI): 54798
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6V1P9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCHS2 is a calcium-dependent cell adhesion molecule belonging to the cadherin superfamily. It plays an important role in cell-cell adhesion, tissue morphogenesis, and signal transduction, especially in forming cell polarity and tissue structure during development.