DCLK2 Polyclonal antibody

• 

  WB analysis using 25450-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25450-1-AP (DCLK2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 25450-1-AP

  IP result of anti-DCLK2 (IP:25450-1-AP, 4ug; Detection:25450-1-AP 1:3000) with mouse brain tissue lysate 2100 ug.

• 

  IF Staining of HepG2 using 25450-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DCLK2 antibody (25450-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

DCLK2 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 25450-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

CaMK-like CREB regulatory kinase 2, CL2, CLICK II, CLICK2, CLICK-II

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25450-1-AP targets DCLK2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22142

  Product name: Recombinant human DCLK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 6-71 aa of BC032726

  Sequence: MLQVNVEARCTAGQILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMFDLTV

• Full Name: doublecortin-like kinase 2
• Calculated Molecular Weight: 766 aa, 84 kDa
• Observed Molecular Weight: 83 kDa
• GenBank Accession Number: BC032726
• Gene Symbol: DCLK2
• Gene ID (NCBI): 166614
• RRID: AB_3085796
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N568
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCLK2 belongs to the protein kinase superfamily, contains two N-terminal doublecortin domains, a C-terminal serine/threonine protein kinase domain, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains. DCLK2 is expressed in the brain, heart and eyes (PMID: 18075264).