DCUN1D2 Polyclonal antibody

• 

  IP experiment of PC-12 using 31696-1-AP

  IP result of anti-DCUN1D2 (IP:31696-1-AP, 4ug; Detection:31696-1-AP 1:500) with PC-12 cells lysate 1040 ug.

DCUN1D2 Polyclonal Antibody for IP, ELISA

Cat No. 31696-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, ELISA

Synonyms

DCUN1L2, C13orf17

---

Tested Applications

• Positive IP detected in: PC-12 cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31696-1-AP targets DCUN1D2 in IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36310

  Product name: Recombinant human DCUN1D2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-73 aa of BC056669

  Sequence: MACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYK

• Full Name: DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC056669
• Gene Symbol: DCUN1D2
• Gene ID (NCBI): 55208
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6PH85
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCUN1D2 (DCN1-like protein 2), also known as DCNL2. It is predicted to be located in the cytoplasm and nucleus. Mostly expressed in liver, kidney and brain (PMID: 26906416). Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes and plays an essential role in the regulation of SCF (SKP1-CUL1-F-box protein)-type complexes activity (PMID: 19617556). The molecular weight of DCUN1D2 is 30 kDa.