DCUN1D2 Polyclonal antibody

DCUN1D2 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 31696-1-AP

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IP, ELISA

Synonyms

C13orf17, DCUN1L2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIPIHC

IP experiment of PC-12 using 31696-1-AP
IP result of anti-DCUN1D2 (IP:31696-1-AP, 4ug; Detection:31696-1-AP 1:500) with PC-12 cells lysate 1040 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 31696-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31696-1-AP (DCUN1D2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 31696-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 31696-1-AP (DCUN1D2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 31696-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 31696-1-AP (DCUN1D2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 31696-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 31696-1-AP (DCUN1D2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 31696-1-AP
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 31696-1-AP (DCUN1D2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 31696-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 31696-1-AP (DCUN1D2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat liver using 31696-1-AP
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 31696-1-AP (DCUN1D2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DCUN1D2 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive IP detected in	PC-12 cells
Positive IHC detected in	human kidney tissue, mouse kidney tissue, rat liver tissue, mouse liver tissue, mouse lung tissue, rat kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31696-1-AP targets DCUN1D2 in IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag36310 Product name: Recombinant human DCUN1D2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 16-73 aa of BC056669 Sequence: MACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYK Predict reactive species
Full Name	DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae)
Observed Molecular Weight	30 kDa
GenBank Accession Number	BC056669
Gene Symbol	DCUN1D2
Gene ID (NCBI)	55208
RRID	AB_3742463
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	Q6PH85
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCUN1D2 (DCN1-like protein 2), also known as DCNL2. It is predicted to be located in the cytoplasm and nucleus. Mostly expressed in liver, kidney and brain (PMID: 26906416). Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes and plays an essential role in the regulation of SCF (SKP1-CUL1-F-box protein)-type complexes activity (PMID: 19617556). The molecular weight of DCUN1D2 is 30 kDa.