DDI2 Polyclonal antibody

• 

  WB analysis using 25377-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25377-1-AP (DDI2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 25377-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DDI2 antibody (25377-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

DDI2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25377-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Protein DDI1 homolog 2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HL-60 tissue, HUVEC tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25377-1-AP targets DDI2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21953

  Product name: Recombinant human DDI2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 22-62 aa of BC006011

  Sequence: DADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLA

• Full Name: DDI1, DNA-damage inducible 1, homolog 2 (S. cerevisiae)
• Calculated Molecular Weight: 399 aa, 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC006011
• Gene Symbol: DDI2
• Gene ID (NCBI): 84301
• RRID: AB_3669472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5TDH0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDI2 contains 399 amino acids and contains an N-terminal ubiquitin-like (UBL) domain and a highly conserved retroviral protease-like (RVP) domain. DDI2 is an aspartic endoprotease that cleaves ubiquitylated target proteins to assist in their processing by the ubiquitin-proteasome system (UPS), especially when the UPS is inhibited(PMID: 32521225).