DDX1 Polyclonal antibody

• 

  WB analysis using 11357-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 11357-1-AP (DDX1 antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11357-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11357-1-AP (DDX1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of PC-3 using 11357-1-AP

  IP result of anti-DDX1 (IP:11357-1-AP, 3ug; Detection:11357-1-AP 1:1000) with PC-3 cells lysate 5000ug.

• 

  IHC staining of human lymphoma using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat skin using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 11357-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11357-1-AP (DDX1 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 11357-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using DDX1 antibody (11357-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

DDX1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11357-1-AP

Publications(25)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

Synonyms

EC:3.6.4.13, DEAD box protein retinoblastoma, DEAD box protein 1, DBP-RB, DBP RB

---

Tested Applications

• Positive WB detected in: HEK-293 cells, A431 cells, HeLa cells, MCF-7 cells, NCI-H1299 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue, PC-3 cells, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human stomach tissue, human lymphoma tissue, human ovary tumor tissue, mouse brain tissue, mouse lung tissue, mouse skin tissue, rat brain tissue, rat lung tissue, rat skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 7 publications below
• WB: See 20 publications below
• IHC: See 3 publications below
• IF: See 7 publications below
• IP: See 4 publications below
• CoIP: See 1 publications below
• RIP: See 3 publications below

Product Information

11357-1-AP targets DDX1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1887

  Product name: Recombinant human DDX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 391-740 aa of BC012132

  Sequence: IPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
• Calculated Molecular Weight: 740 aa, 82 kDa
• Observed Molecular Weight: 70-82 kDa
• GenBank Accession Number: BC012132
• Gene Symbol: DDX1
• Gene ID (NCBI): 1653
• RRID: AB_2092222
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92499
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX1 is a DEAD box protein, which is putative RNA helicases with a characteristic asp-glu-ala-asp (DEAD) box motif. DEAD box proteins involve in translation initiation, splicing, and ribosome and spliceosome assembly by altering RNA secondary structure. As a RNA helicase, DDX1 has a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell; Modulation of RNA Condensation by the DEAD-Box Protein eIF4A.; Authors - Devin Tauber
mouse	WB,CoIP,IP	Mol Cell; RNA Helicase DDX1 Converts RNA G-Quadruplex Structures into R-Loops to Promote IgH Class Switch Recombination.; Authors - Claudia Ribeiro de Almeida ; KD Validated
human	WB	Cell Host Microbe; RNase L Activates the NLRP3 Inflammasome during Viral Infections.; Authors - Arindam Chakrabarti ; KD Validated
mouse	WB	Nat Commun; BEX1 is an RNA-dependent mediator of cardiomyopathy.; Authors - Federica Accornero
rat	WB,IF	Nucleic Acids Res; PMID: 30295850; Authors - Zonghong Li ; KD Validated
mouse	IF	Cell Syst; BraInMap Elucidates the Macromolecular Connectivity Landscape of Mammalian Brain.; Authors - Reza Pourhaghighi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ilham (Verified Customer) (08-06-2024)

It works very well - the AB was diluted 1:2000 in 5% BSA -chemiluminescence blots using the ChemiDoc Imaging System.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000