DDX19B Polyclonal antibody, PBS Only

• 

  WB analysis of K-562 using 18285-1-AP (same clone as 18285-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 18285-1-AP (DDX19B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18285-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 18285-1-AP (same clone as 18285-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18285-1-AP (DDX19B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18285-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 18285-1-AP (same clone as 18285-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 18285-1-AP (DDX19B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18285-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 18285-1-AP (same clone as 18285-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18285-1-AP (DDX19B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18285-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 18285-1-AP (same clone as 18285-1-PBS)

  IP result of anti-DDX19B (IP:18285-1-AP, 4ug; Detection:18285-1-AP 1:500) with K-562 cells lysate 4000ug. This data was developed using the same antibody clone with 18285-1-PBS in a different storage buffer formulation.

DDX19B Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 18285-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

18285-1-PBS targets DDX19B in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13165

  Product name: Recombinant human DDX19B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-370 aa of BC010008

  Sequence: MGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

• Full Name: DEAD (Asp-Glu-Ala-As) box polypeptide 19B
• Calculated Molecular Weight: 479aa,54 kDa; 370aa,42 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC010008
• Gene Symbol: DDX19B
• Gene ID (NCBI): 11269
• RRID: AB_10597088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UMR2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.