Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | mouse testis tissue, mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IHC | See 4 publications below |
| IF | See 9 publications below |
| IP | See 1 publications below |
Product Information
51042-1-AP targets DDX4,VASA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0447 Product name: Recombinant human DDX4,VASA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 35-163 aa of BC047455 Sequence: NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGDNDLDPDECMQRTGGLFGSRRPVLSGTGNGDT Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 |
| Calculated Molecular Weight | 690aa,76 kDa; 724aa,79 kDa |
| Observed Molecular Weight | 79 kDa |
| GenBank Accession Number | BC047455 |
| Gene Symbol | DDX4 |
| Gene ID (NCBI) | 54514 |
| RRID | AB_2092998 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQI0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DEAD box proteins are characterized by nine conserved sequence motifs located on two functional domains. Domain I contains six of these motifs, including the Q motif and the Walker A motif, motifs Ia and Ib, the Walker B motif, and motif III, which may act to link ATPase and helicase activities of the protein [PMID:21653890]. DDX4, a member of the DEAD box family of ATP-dependent RNA helicases, plays a central role in several aspects of germ cell development. Its function is not only required during gametogenesis in the adult but is also essential for the specification of the germ cell lineage during embryogenesis [PMID:20016130].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DDX4,VASA antibody 51042-1-AP | Download protocol |
| IHC protocol for DDX4,VASA antibody 51042-1-AP | Download protocol |
| IP protocol for DDX4,VASA antibody 51042-1-AP | Download protocol |
| WB protocol for DDX4,VASA antibody 51042-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Environ Pollut Wnt10a downregulation contributes to MEHP-induced disruption of self-renewal and differentiation balance and proliferation inhibition in GC-1 cells: Insights from multiple transcriptomic profiling | ||
Oncotarget Generation and characteristics of human Sertoli cell line immortalized by overexpression of human telomerase. | ||
J Pharmacol Sci Berberine protects cyclophosphamide and busulfan-induced premature ovarian insufficiency in mouse model | ||
STAR Protoc Optimized protocol for isolation of germ cells from mouse testis by centrifugal elutriation. | ||
Int J Mol Sci Tracking Immature Testicular Tissue after Vitrification In Vitro and In Vivo for Pre-Pubertal Fertility Preservation: A Translational Transgenic Mouse Model |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Hetty (Verified Customer) (04-10-2018) | very good antibody.
|

















