CoraLite® Plus 488-conjugated DDX4/VASA Polyclonal antibody

DDX4/VASA Polyclonal Antibody for IF-P
Cat No. CL488-51042

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

DDX4,VASA, DDX4, EC:3.6.4.13, Probable ATP-dependent RNA helicase DDX4, VASA

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse testis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-51042 targets DDX4/VASA in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0447

Product name: Recombinant human DDX4,VASA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 35-163 aa of BC047455

Sequence: NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGDNDLDPDECMQRTGGLFGSRRPVLSGTGNGDT

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 4
Calculated Molecular Weight690aa,76 kDa; 724aa,79 kDa
Observed Molecular Weight 79 kDa
GenBank Accession NumberBC047455
Gene Symbol DDX4
Gene ID (NCBI) 54514
RRIDAB_3672850
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NQI0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DEAD box proteins are characterized by nine conserved sequence motifs located on two functional domains. Domain I contains six of these motifs, including the Q motif and the Walker A motif, motifs Ia and Ib, the Walker B motif, and motif III, which may act to link ATPase and helicase activities of the protein [PMID:21653890]. DDX4, a member of the DEAD box family of ATP-dependent RNA helicases, plays a central role in several aspects of germ cell development. Its function is not only required during gametogenesis in the adult but is also essential for the specification of the germ cell lineage during embryogenesis [PMID:20016130].

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DDX4/VASA antibody CL488-51042Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...