DEFA1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DEFA1 Polyclonal antibody (18057-1-AP)

DEFA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18057-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

HP 1-56, HNP-1, defensin, alpha 1, DEFA2, DEFA1B

• 

  WB analysis of HepG2 using 18057-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18057-1-AP (DEFA1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 18057-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 18057-1-AP (DEFA1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human small intestine using 18057-1-AP

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 18057-1-AP (DEFA1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18057-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18057-1-AP (DEFA1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 18057-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18057-1-AP (DEFA1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 18057-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 18057-1-AP (DEFA1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DEFA1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IHC detected in: human small intestine tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18057-1-AP targets DEFA1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12592

  Product name: Recombinant human DEFA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-94 aa of BC093791

  Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

• Full Name: defensin, alpha 1
• Calculated Molecular Weight: 94 aa, 10 kDa
• Observed Molecular Weight: 6 kDa
• GenBank Accession Number: BC093791
• Gene Symbol: DEFA1
• Gene ID (NCBI): 1667
• RRID: AB_2292842
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P59665
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The DEFA1 Polyclonal antibody (Cat# 18057-1-AP) has 4 citations published in Life Sciences, Mediators of Inflammation, Human Cell, and Systems Biology in Reproductive Medicine. Research fields span virology and cell cycle regulation (ZIKV replication), gut microbiome and fetal growth restriction, non-small cell lung cancer progression (HDAC6/TMEM100 axis), and ovarian endometriotic cyst proteomics. Applications cited include WB, CoIP, and IHC in human samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Life Sci; DEFA1B inhibits ZIKV replication and retards cell cycle progression through interaction with ORC1.; Authors - Shuang Li
human	WB	Mediators Inflamm; Potential Association of Gut Microbial Metabolism and Circulating mRNA Based on Multiomics Sequencing Analysis in Fetal Growth Restriction; Authors - Hui Tang
human	WB	Hum Cell; Histone deacetylase 6-mediated downregulation of TMEM100 expedites the development and progression of non-small cell lung cancer.; Authors - Yanyun Wang
human	IHC	Syst Biol Reprod Med; Identification of differentially expressed proteins associated with recurrence in ovarian endometriotic cysts.; Authors - Genhai Zhu