Tested Applications
Positive WB detected in | HepG2 cells |
Positive IHC detected in | human small intestine tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 1 publications below |
CoIP | See 1 publications below |
Product Information
18057-1-AP targets DEFA1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12592 Product name: Recombinant human DEFA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC093791 Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC Predict reactive species |
Full Name | defensin, alpha 1 |
Calculated Molecular Weight | 94 aa, 10 kDa |
Observed Molecular Weight | 6 kDa |
GenBank Accession Number | BC093791 |
Gene Symbol | DEFA1 |
Gene ID (NCBI) | 1667 |
RRID | AB_2292842 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P59665 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DEFA1 antibody 18057-1-AP | Download protocol |
IHC protocol for DEFA1 antibody 18057-1-AP | Download protocol |
IF protocol for DEFA1 antibody 18057-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Life Sci DEFA1B inhibits ZIKV replication and retards cell cycle progression through interaction with ORC1. | ||
Hum Cell Histone deacetylase 6-mediated downregulation of TMEM100 expedites the development and progression of non-small cell lung cancer. | ||
Syst Biol Reprod Med Identification of differentially expressed proteins associated with recurrence in ovarian endometriotic cysts. | ||
Mediators Inflamm Potential Association of Gut Microbial Metabolism and Circulating mRNA Based on Multiomics Sequencing Analysis in Fetal Growth Restriction |