DEFB119 Polyclonal antibody

• 

  WB analysis using 33236-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33236-1-AP (DEFB119 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

DEFB119 Polyclonal Antibody for WB, ELISA

Cat No. 33236-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Beta-defensin 119, Beta-defensin 120, Beta-defensin 19, Beta-defensin 20, DEFB120

---

Tested Applications

• Positive WB detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33236-1-AP targets DEFB119 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36816

  Product name: Recombinant human DEFB119 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 22-84 aa of BC062212

  Sequence: KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP

• Full Name: defensin, beta 119
• Calculated Molecular Weight: 84 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC062212
• Gene Symbol: DEFB119
• Gene ID (NCBI): 245932
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N690
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DEFB119 is a reproductive tract-specific β-defensin highly expressed in the testis and the epididymis (16). Single-cell sequencing analysis of testicular cells isolated from nonobstructive azoospermia men demonstrates an elevated expression of DEFB119 in the Sertoli cells. Male mice lacking the mouse ortholog DEFB19 demonstrated subfertility in both sexes. DEFB119 is also expressed in sperm and is involved in sperm chemotaxis. Elevated seminal DEFB119 was associated with a decrease in the observed genera, diversity and evenness of bacterial communities, and further distortion of the metacommunities (PMID: 39359400).