DFNA5/GSDME Polyclonal antibody, PBS Only

• 

  WB analysis using 31363-1-AP (same clone as 31363-1-PBS)

  Untreated, and etoposide (60uM, 14h) treated SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 31363-1-AP (DFNA5/GSDME antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31363-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31363-1-AP (same clone as 31363-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31363-1-AP (DFNA5/GSDME antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31363-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 31363-1-AP (same clone as 31363-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 31363-1-AP (DFNA5/GSDME antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31363-1-PBS in a different storage buffer formulation.

• 

  IP experiment of SH-SY5Y using 31363-1-AP (same clone as 31363-1-PBS)

  IP result of anti-DFNA5/GSDME (IP:31363-1-AP, 4ug; Detection:31363-1-AP 1:800) with SH-SY5Y cells lysate 6790 ug. This data was developed using the same antibody clone with 31363-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31363-1-AP (same clone as 31363-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31363-1-AP (DFNA5 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31363-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31363-1-AP (same clone as 31363-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31363-1-AP (DFNA5 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31363-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 31363-1-AP (same clone as 31363-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using DFNA5 antibody (31363-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31363-1-PBS in a different storage buffer formulation.

DFNA5/GSDME Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 31363-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

DFNA5, Gasdermin E, Gasdermin-E, GSDME, deafness, autosomal dominant 5

---

Product Information

31363-1-PBS targets DFNA5/GSDME in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35186

  Product name: Recombinant human DFNA5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-190 aa of BC019689

  Sequence: NVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPDAAHGISSQDGPLSVLKQATLLLERNFHPFA

• Full Name: deafness, autosomal dominant 5
• Calculated Molecular Weight: 496 aa, 55 kDa
• Observed Molecular Weight: 55 kDa, 35 kDa, 25 kDa
• GenBank Accession Number: BC019689
• Gene Symbol: DFNA5
• Gene ID (NCBI): 1687
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O60443
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DFNA5 (deafness, autosomal dominant 5), also known as GSDME or ICERE-1, is a 496 amino acid protein that is expressed in cochlea tissue, as well as in placenta, brain, heart, liver, lung and pancreas. Defects in the gene encoding DFNA5 are the cause of non-syndromic sensorineural deafness autosomal dominant type 5 (DFNA5), a form of sensorineural hearing loss that results from damage to one of various structures that receive sound information in the brain. GSDME produced two GSDME fragments with MW of 35 kDa and 25 kDa.