Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

DGKA Polyclonal antibody

DGKA Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

DAGK, DAGK1, DGK alpha, DGK-alpha, EC:2.7.1.107

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for DGKA in ?

Tested Applications

Positive WB detected inJurkat cells, human cerebellum tissue, HEK-293 cells, mouse cerebellum tissue, MOLT-4 cells, HeLa cells
Positive IP detected inJurkat cells
Positive IHC detected inhuman gliomas tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inJurkat cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11547-1-AP targets DGKA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2075

Product name: Recombinant human DGKA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 115-501 aa of BC023523

Sequence: LEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWS

Predict reactive species
Full Name diacylglycerol kinase, alpha 80kDa
Calculated Molecular Weight 735 aa, 83 kDa
Observed Molecular Weight 83 kDa
GenBank Accession NumberBC023523
Gene Symbol DGKA
Gene ID (NCBI) 1606
RRIDAB_2245857
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23743
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DGKA (Diacylglycerol kinase alpha) is also named as DAGK, DAGK1 and belongs to the eukaryotic diacylglycerol kinase family, which is suggested to attenuate diacylglycerol-induced cell responses through the phosphorylation of this second messenger to phosphatidic acid (PMID: 39684917). DGKA regulates the secretion of lethal exosomes bearing Fas ligand during activation-induced cell death of T lymphocytes, the inhibition of DGKA induces prolonged activation signals via sustained signaling through RasGRP (Ras guanyl nucleotide exchange factor). A series of studies have reported that abnormal expression of DGKA in some types of tumors is related to survival prognosis, such as hepatocellular carcinoma, non-small cell lung cancer, esophageal squamous cell carcinoma, gastric cancer and so on(PMID: 22425622, PMID: 35131384, PMID: 30532074, PMID: 17276726, PMID: 23558954).

Protocols

Product Specific Protocols
FC protocol for DGKA antibody 11547-1-APDownload protocol
IF protocol for DGKA antibody 11547-1-APDownload protocol
IHC protocol for DGKA antibody 11547-1-APDownload protocol
IP protocol for DGKA antibody 11547-1-APDownload protocol
WB protocol for DGKA antibody 11547-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-DGKα antibody (Cat# 11547-1-AP) has 24 citations published in journals including Nature Communications, Nature Chemical Biology, EMBO Journal, Cancer Discovery, Clinical Cancer Research, Journal of Investigative Dermatology, Frontiers in Immunology, and Science Signaling. Research fields span lipid metabolism, glioblastoma, ovarian and gastric cancer, immune cell signaling (T cells, B cells, NK cells, macrophages), radiation-induced fibrosis, liver disease, and melanocyte biology.

SpeciesApplicationTitle
humanWB

Cancer Discov

Diacylglycerol Kinase α Is a Critical Signaling Node and Novel Therapeutic Target in Glioblastoma and Other Cancers.

Authors - Dominguez Charli L CL
  • KD Validated
humanIHC

Cancer Commun (Lond)

Multiomics analysis reveals metabolic subtypes and identifies diacylglycerol kinase α (DGKA) as a potential therapeutic target for intrahepatic cholangiocarcinoma

Authors - Weiren Liu
humanWB

Nat Commun

Epigenetic regulation of diacylglycerol kinase alpha promotes radiation-induced fibrosis.

Authors - Christoph Weigel

Nat Commun

Mutant p53s generate pro-invasive niches by influencing exosome podocalyxin levels.

Authors - David Novo
humanWB

Nat Chem Biol

Reprogramming fatty acyl specificity of lipid kinases via C1 domain engineering.

Authors - Timothy B Ware
  • KD Validated
mouseWB

Acta Pharm Sin B

Macrophage DGKζ-mediated phosphatidic acid remodeling aggravates acute liver failure.

Authors - Yumeng Miao
Loading...
||
New chat

Able™

正在加载,请稍候...