Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells, MOLT-4 cells, human cerebellum tissue, HEK-293 cells, mouse cerebellum tissue |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human gliomas tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Jurkat cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 18 publications below |
| IHC | See 6 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
11547-1-AP targets DGKA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2075 Product name: Recombinant human DGKA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 115-501 aa of BC023523 Sequence: LEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWS Predict reactive species |
| Full Name | diacylglycerol kinase, alpha 80kDa |
| Calculated Molecular Weight | 735 aa, 83 kDa |
| Observed Molecular Weight | 83 kDa |
| GenBank Accession Number | BC023523 |
| Gene Symbol | DGKA |
| Gene ID (NCBI) | 1606 |
| RRID | AB_2245857 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23743 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DGKA (Diacylglycerol kinase alpha) is also named as DAGK, DAGK1 and belongs to the eukaryotic diacylglycerol kinase family, which is suggested to attenuate diacylglycerol-induced cell responses through the phosphorylation of this second messenger to phosphatidic acid (PMID: 39684917). DGKA regulates the secretion of lethal exosomes bearing Fas ligand during activation-induced cell death of T lymphocytes, the inhibition of DGKA induces prolonged activation signals via sustained signaling through RasGRP (Ras guanyl nucleotide exchange factor). A series of studies have reported that abnormal expression of DGKA in some types of tumors is related to survival prognosis, such as hepatocellular carcinoma, non-small cell lung cancer, esophageal squamous cell carcinoma, gastric cancer and so on(PMID: 22425622, PMID: 35131384, PMID: 30532074, PMID: 17276726, PMID: 23558954).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for DGKA antibody 11547-1-AP | Download protocol |
| IF protocol for DGKA antibody 11547-1-AP | Download protocol |
| IHC protocol for DGKA antibody 11547-1-AP | Download protocol |
| IP protocol for DGKA antibody 11547-1-AP | Download protocol |
| WB protocol for DGKA antibody 11547-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Mutant p53s generate pro-invasive niches by influencing exosome podocalyxin levels. | ||
Nat Chem Biol Reprogramming fatty acyl specificity of lipid kinases via C1 domain engineering.
| ||
Nat Commun Epigenetic regulation of diacylglycerol kinase alpha promotes radiation-induced fibrosis. | ||
EMBO J Dysfunctional natural killer cells can be reprogrammed to regain anti-tumor activity | ||
Cancer Discov Diacylglycerol Kinase α Is a Critical Signaling Node and Novel Therapeutic Target in Glioblastoma and Other Cancers.
| ||
Clin Cancer Res DGKA Provides Platinum Resistance in Ovarian Cancer Through Activation of c-JUN-WEE1 Signaling.
|



























