Tested Applications
| Positive WB detected in | Jurkat cells, human cerebellum tissue, HEK-293 cells, mouse cerebellum tissue, MOLT-4 cells, HeLa cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human gliomas tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Jurkat cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11547-1-AP targets DGKA in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2075 Product name: Recombinant human DGKA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 115-501 aa of BC023523 Sequence: LEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWS Predict reactive species |
| Full Name | diacylglycerol kinase, alpha 80kDa |
| Calculated Molecular Weight | 735 aa, 83 kDa |
| Observed Molecular Weight | 83 kDa |
| GenBank Accession Number | BC023523 |
| Gene Symbol | DGKA |
| Gene ID (NCBI) | 1606 |
| RRID | AB_2245857 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23743 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DGKA (Diacylglycerol kinase alpha) is also named as DAGK, DAGK1 and belongs to the eukaryotic diacylglycerol kinase family, which is suggested to attenuate diacylglycerol-induced cell responses through the phosphorylation of this second messenger to phosphatidic acid (PMID: 39684917). DGKA regulates the secretion of lethal exosomes bearing Fas ligand during activation-induced cell death of T lymphocytes, the inhibition of DGKA induces prolonged activation signals via sustained signaling through RasGRP (Ras guanyl nucleotide exchange factor). A series of studies have reported that abnormal expression of DGKA in some types of tumors is related to survival prognosis, such as hepatocellular carcinoma, non-small cell lung cancer, esophageal squamous cell carcinoma, gastric cancer and so on(PMID: 22425622, PMID: 35131384, PMID: 30532074, PMID: 17276726, PMID: 23558954).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for DGKA antibody 11547-1-AP | Download protocol |
| IF protocol for DGKA antibody 11547-1-AP | Download protocol |
| IHC protocol for DGKA antibody 11547-1-AP | Download protocol |
| IP protocol for DGKA antibody 11547-1-AP | Download protocol |
| WB protocol for DGKA antibody 11547-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-DGKα antibody (Cat# 11547-1-AP) has 24 citations published in journals including Nature Communications, Nature Chemical Biology, EMBO Journal, Cancer Discovery, Clinical Cancer Research, Journal of Investigative Dermatology, Frontiers in Immunology, and Science Signaling. Research fields span lipid metabolism, glioblastoma, ovarian and gastric cancer, immune cell signaling (T cells, B cells, NK cells, macrophages), radiation-induced fibrosis, liver disease, and melanocyte biology.
| Species | Application | Title |
|---|---|---|
Cancer Discov Diacylglycerol Kinase α Is a Critical Signaling Node and Novel Therapeutic Target in Glioblastoma and Other Cancers.
| ||
Cancer Commun (Lond) Multiomics analysis reveals metabolic subtypes and identifies diacylglycerol kinase α (DGKA) as a potential therapeutic target for intrahepatic cholangiocarcinoma | ||
Nat Commun Epigenetic regulation of diacylglycerol kinase alpha promotes radiation-induced fibrosis. | ||
Nat Commun Mutant p53s generate pro-invasive niches by influencing exosome podocalyxin levels. | ||
Nat Chem Biol Reprogramming fatty acyl specificity of lipid kinases via C1 domain engineering.
| ||
Acta Pharm Sin B Macrophage DGKζ-mediated phosphatidic acid remodeling aggravates acute liver failure. |
