DHRS7C Polyclonal antibody, PBS Only

• 

  WB analysis using 26020-1-AP (same clone as 26020-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26020-1-AP (DHRS7C antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26020-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 26020-1-AP (same clone as 26020-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 26020-1-AP (DHRS7C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26020-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 26020-1-AP (same clone as 26020-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 26020-1-AP (DHRS7C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26020-1-PBS in a different storage buffer formulation.

DHRS7C Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26020-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26020-1-PBS targets DHRS7C in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23392

  Product name: Recombinant human DHRS7C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 206-308 aa of BC147025

  Sequence: VEEYDVVISTVSPTFIRSYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIPKAAVYVRTFFPEFFFAVVACGVKEKLNVPEEG

• Full Name: dehydrogenase/reductase (SDR family) member 7C
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC147025
• Gene Symbol: DHRS7C
• Gene ID (NCBI): 201140
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A6NNS2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DHRS7C also known as SDR32C2, is a member of the large short-chain dehydrogenase/reductase (SDR) family of enzymes that metabolize steroid hormones, prostaglandins, retinoids, lipids, and xenobiotics (PMID: 19027726). DHRS7C is involved in regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum. DHRS7C is localized to the endo/sarcoplasmic reticulumis, and expression levels were highest in heart and skeletal muscle followed by skin but were not detectable in other organs (PMID: 22143674).