DHX29 Polyclonal antibody

• 

  WB analysis of HEK-293 using 13923-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13923-1-AP (DHX29 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 13923-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13923-1-AP (DHX29 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 13923-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13923-1-AP (DHX29 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 13923-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 13923-1-AP (DHX29 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 13923-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 13923-1-AP (DHX29 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13923-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13923-1-AP (DHX29 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 13923-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 13923-1-AP (DHX29 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DHX29 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13923-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ATP-dependent RNA helicase DHX29, DDX29, DEAH box protein 29, EC:3.6.4.13, Nucleic acid helicase DDXx

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, HT-1080 cells, K-562 cells, MCF-7 cells, PC-3 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13923-1-AP targets DHX29 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4938

  Product name: Recombinant human DHX29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1025-1369 aa of BC056219

  Sequence: CNLGSPEDFLSKALDPPQLQVISNAMNLLRKIGACELNEPKLTPLGQHLAALPVNVKIGKMLIFGAIFGCLDPVATLAAVMTEKSPFTTPIGRKDEADLAKSALAMADSDHLTIYNAYLGWKKARQEGGYRSEITYCRRNFLNRTSLLTLEDVKQELIKLVKAAGFSSSTTSTSWEGNRASQTLSFQEIALLKAVLVAGLYDNVGKIIYTKSVDVTEKLACIVETAQGKAQVHPSSVNRDLQTHGWLLYQEKIRYARVYLRETTLITPFPVLLFGGDIEVQHRERLLSIDGWIYFQAPVKIAVIFKQLRVLIDSVLRKKLENPKMSLENDKILQIITELIKTENN

• Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 29
• Calculated Molecular Weight: 155 kDa
• Observed Molecular Weight: 150-155 kDa
• GenBank Accession Number: BC056219
• Gene Symbol: DHX29
• Gene ID (NCBI): 54505
• RRID: AB_2092005
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z478
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Lilas (Verified Customer) (06-29-2021)

Used antibody at a 1:1000 dilution in 5% BSA, and overnight incubation at 4 degrees. A very sharp band detected at around 155 kDA using western blot.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Glioblastoma cell lines